Details for Kale Locus Bo5g123350

Position : C5 ( 5`- 37802404 .. 37803334 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g123350

Protein [Map View]
MADGIPTTSFFWIWSEICQYSVANVRRPWCPSEAPLELGVFSCGVYFGMGSVEVGDVESPLHATWSLVFLISSLYGRDSF
INPPRACLNPILGRRGSKPLPLIAAAKKKKSKKDDNHSFSARLDEATGPFPESILLKEKKIDEEIDLLPDIDDAEESK*

DNA
ATGGCCGACGGAATTCCGACGACTTCATTTTTTTGGATTTGGTCGGAAATTTGTCAGTATTCCGTCGCAAATGTCCGACG
ACCTTGGTGTCCGTCGGAAGCTCCGTTGGAATTAGGAGTGTTTTCTTGTGGTGTATATTTTGGAATGGGTTCTGTAGAGG
TTGGAGATGTGGAGTCACCCCTACACGCCACTTGGTCTCTGGTGTTTCTTATATCCAGTTTATATGGCCGAGATTCGTTC
ATCAACCCGCCACGCGCGTGTTTGAATCCTATTCTCGGCCGCAGAGGATCTAAACCTCTTCCTTTGATCGCCGCCGCAAA
GAAGAAGAAGAGCAAGAAAGATGACAACCATAGCTTCTCCGCTAGACTTGACGAAGCCACCGGTCCATTTCCTGAATCCA
TCCTTCTCAAAGAGAAGAAGATTGATGAGGAAATTGATCTTCTTCCTGATATCGATGATGCTGAAGAAAGTAAGTGA