Details for Kale Locus Bo5g123320

Position : C5 ( 5`- 37762391 .. 37769028 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g123320

Protein [Map View]
MFFSGDPSTRKRVDLGGRSTKERDARKLLEQTRMERNRRLLQKQQNAAALKIQKFFRGRRSVATERSKVRREFCETYGDN
CQNVDRHCFEPGSSFLRQFLFFFKAKNSGDFLILVETCRLLKMFAHSNGDILSLFSGSDYSAEHNLVDFRVKELAFTCIE
AIHQNRDRLRDQLLVTTEEASTSTAILMEAMSLVLDPKLPWVCKTVSYLQKRHIFKLVREIVITAKENPRGQTKTGNILS
LERVLILVVSHVGREPCCCPVDDPRWSFSSMILTLPLIWQLFPNLKVVFANPNLSQHYIHQMAFCIQKDTHVLPIDTSTE
FPGYACLLGNTLETANVVLSQPDCSLDMAVDIASVATFLLEKLPPVKSSERESKQSSSEEDDMLIDDIPELVLNKTLEQQ
ITSNAIDSRFLLQLTNVLFHQVSLGTQPYDEDKEAQAIGTASSFLYAAFNTLPLERIMTVLAYRTELVVVLWNYMKRCHE
NQKWSSMPNLLAYLPGDAPGWLLPLVVFCPVYKHMLMIVDNEEFYEREKPLSLQDIRLLIIILKQALWQLLWVNPLTQPS
TGKSVSNNLSKKNPVGLIQNRVGVVVAELLSQLQDWNNRQQFTSSSDFQADTVNEYFISQAIAEGTRANYILMHAPFLIP
FTSRVKIFTTQLATARESHGHGSQAIFARNRFRIRRDHILEDAYNQMSALSEDDLRGSIRVTFVNELGVEEAGIDGGGIF
KDFMEKITRAAFDVQYGLFKETVDHMLYPNPGSGMVHDQHLQFFHFLGTLLAKAMFEGILVDIPFATFFLSKLKHKYNYL
NDLPSLDPELYKHLIFLKRYKGNIAELELYFVILNNEYGERTEEELLQGGKDMRVTNENVITFIHLVSNHRLNFQIRQQS
SHFLRGFQQLIPKECIDMFNEHELQVLISGSADYLDIDDLRQNTNYTGGYNAGHYVIDMFWEVLKSFSTENQKKFLKFVT
GCSRGPLLGFKYLEPAFCIQRAAGSASNEAVDRLPTSATCMNLLKLPPYQSKEQLETKLMYAISAEAGFDLS*

DNA
ATGTTTTTCTCCGGCGATCCGTCGACTCGGAAGCGAGTTGATTTAGGTGGCCGGAGCACTAAGGAGAGAGATGCTCGGAA
GCTTCTGGAGCAGACCAGGATGGAGCGTAATCGCCGTCTGCTTCAGAAGCAGCAGAATGCCGCTGCCCTCAAAATTCAGA
AATTCTTTAGAGGTAGAAGATCAGTGGCCACTGAGCGCTCCAAGGTGAGGCGTGAGTTCTGTGAAACCTATGGGGATAAT
TGCCAGAATGTCGATAGGCATTGCTTTGAGCCAGGTTCAAGCTTCCTCCGTCAGTTTCTGTTTTTCTTCAAGGCAAAAAA
CTCGGGGGATTTTCTGATACTTGTGGAGACGTGTCGCCTACTGAAAATGTTTGCTCACAGCAATGGTGACATTCTCAGCC
TTTTCTCTGGCTCGGACTATTCCGCTGAGCATAATTTGGTGGATTTTAGAGTAAAGGAACTTGCTTTTACCTGCATTGAG
GCTATACATCAGAATAGGGACCGTTTAAGGGATCAGCTGTTAGTTACCACTGAAGAAGCCAGCACCTCAACAGCTATATT
GATGGAGGCGATGTCATTGGTGCTAGATCCTAAGCTGCCTTGGGTTTGCAAAACTGTGAGTTATCTACAGAAAAGACACA
TATTCAAACTGGTCAGAGAAATCGTCATTACAGCTAAGGAAAACCCTAGAGGTCAGACTAAGACCGGCAACATTCTTTCA
CTTGAAAGAGTATTGATCCTGGTAGTATCTCATGTTGGCCGTGAGCCATGTTGCTGCCCTGTTGATGATCCACGTTGGAG
CTTCTCATCTATGATCCTTACATTGCCCTTGATATGGCAGCTCTTCCCAAACCTGAAAGTGGTCTTTGCCAACCCAAATC
TAAGTCAACATTACATTCACCAGATGGCTTTCTGTATTCAAAAGGATACCCATGTTCTCCCAATAGATACAAGCACAGAG
TTCCCTGGTTATGCTTGTCTTCTTGGTAATACGTTGGAAACTGCAAATGTGGTGTTGTCACAGCCTGACTGTTCATTGGA
TATGGCAGTTGACATTGCATCAGTTGCAACTTTCTTGTTAGAGAAACTTCCTCCTGTGAAGTCATCAGAAAGAGAAAGCA
AACAGAGCTCTTCTGAGGAGGATGATATGTTGATTGACGATATACCAGAATTAGTCCTGAATAAGACTCTGGAGCAGCAG
ATAACCTCCAATGCTATAGACTCACGTTTTCTTCTGCAGTTAACAAATGTTTTGTTCCATCAAGTTTCGCTTGGTACACA
GCCATATGATGAAGATAAAGAAGCACAAGCTATTGGCACAGCCAGTTCTTTTCTGTATGCAGCATTCAACACTCTCCCTC
TTGAGAGAATCATGACAGTTTTGGCTTATAGAACGGAGCTTGTAGTTGTGCTGTGGAATTATATGAAACGATGCCATGAG
AACCAGAAGTGGTCATCCATGCCTAATCTCCTAGCTTACCTTCCAGGAGATGCTCCGGGTTGGCTATTACCTCTGGTTGT
TTTTTGTCCTGTTTATAAGCATATGCTTATGATAGTCGACAATGAGGAGTTTTACGAACGGGAGAAGCCACTGTCGCTAC
AAGATATCAGGTTGCTTATCATCATTCTCAAGCAAGCTTTATGGCAGTTACTATGGGTGAATCCACTTACGCAGCCTAGC
ACGGGGAAATCTGTCTCCAACAACCTCTCAAAGAAGAACCCTGTTGGCTTGATTCAGAACAGGGTTGGGGTTGTAGTTGC
TGAATTACTTTCACAGTTACAAGATTGGAACAACCGGCAACAATTCACTTCCTCGAGCGATTTCCAAGCTGATACAGTCA
ACGAATATTTTATCTCTCAGGCAATAGCGGAAGGTACAAGAGCCAACTACATACTGATGCACGCTCCTTTCCTGATTCCG
TTTACAAGCAGAGTCAAGATTTTCACAACACAATTAGCAACGGCGAGGGAGAGTCATGGTCATGGATCTCAAGCCATTTT
TGCTCGAAATCGGTTCAGAATACGAAGAGATCACATCTTGGAAGATGCTTACAATCAAATGAGTGCATTGTCAGAAGATG
ATCTCCGGGGATCGATTCGCGTGACATTTGTCAATGAACTTGGAGTTGAGGAAGCTGGTATTGATGGTGGTGGCATTTTT
AAAGACTTCATGGAGAAAATTACCCGAGCAGCCTTTGATGTGCAATATGGGTTGTTTAAGGAGACCGTTGATCACATGCT
TTATCCTAATCCTGGATCAGGAATGGTACATGACCAGCATCTCCAGTTCTTTCATTTTCTCGGCACTCTTCTCGCAAAAG
CTATGTTTGAAGGGATTCTAGTTGATATACCATTTGCAACTTTTTTCCTCAGCAAATTGAAACACAAGTACAACTATTTG
AACGATTTGCCTTCTCTGGATCCTGAGTTGTATAAGCATCTTATATTTCTGAAGCGTTATAAGGGTAATATCGCAGAGTT
GGAGCTTTACTTTGTTATTCTCAACAACGAATATGGAGAGAGGACAGAGGAAGAGTTACTTCAAGGGGGTAAAGACATGC
GGGTTACAAATGAGAATGTTATAACTTTCATTCATCTGGTTTCAAATCATCGGTTGAATTTTCAGATACGCCAACAGAGT
TCTCATTTCTTGAGAGGGTTTCAGCAACTCATTCCAAAAGAATGTATCGACATGTTCAATGAACATGAGCTTCAGGTTCT
TATATCTGGTTCAGCTGATTATTTGGATATTGACGACTTGCGTCAGAACACTAACTATACAGGAGGCTACAACGCTGGAC
ATTATGTGATTGATATGTTCTGGGAAGTTCTGAAAAGCTTCTCAACCGAAAACCAGAAGAAGTTCTTAAAATTTGTGACA
GGCTGTTCGAGAGGACCACTGCTTGGTTTCAAATACTTGGAACCTGCATTCTGTATACAGAGGGCTGCGGGTAGCGCGAG
TAATGAAGCAGTTGATAGACTACCTACATCAGCCACTTGTATGAACCTTCTCAAGCTTCCTCCCTATCAAAGCAAAGAGC
AACTTGAGACCAAATTGATGTACGCCATAAGCGCAGAAGCAGGTTTTGACCTGAGCTGA