Details for Kale Locus Bo5g123260

Position : C5 ( 5`- 37681675 .. 37682247 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g123260

Protein [Map View]
MVFSCVTRNMFSVLHLLALVLISITPLCSSYTPSDKVTKELVVQLCSKPTLYKNFCIAWLFSDPKTLTLDLHGLLGMVIE
KTQGFGFRTIKLTKGLVNTTTDPNLKMIYGSCLTDYEQSTKGIEIAKGYASSKVYFSAFMAAYKAMMAISDCETLIEAQP
IPAYFSRRVVMFERMCSTGMVFSKVLKEGK*

DNA
ATGGTTTTTTCTTGCGTCACAAGAAACATGTTCTCGGTTCTTCATCTTCTCGCCCTCGTTCTCATATCAATCACCCCTTT
GTGTTCATCTTATACTCCAAGTGACAAAGTCACAAAAGAATTAGTCGTCCAACTCTGCTCAAAACCGACACTTTACAAAA
ACTTCTGCATCGCTTGGCTGTTCTCCGACCCAAAAACATTAACCCTCGACTTACACGGTCTTCTCGGTATGGTCATCGAA
AAGACCCAAGGGTTTGGGTTCAGGACCATAAAGTTGACGAAAGGTTTAGTGAACACCACAACTGATCCAAATCTCAAGAT
GATATATGGGTCTTGCTTGACAGATTATGAACAATCCACTAAAGGGATCGAGATAGCAAAAGGATATGCCAGCTCCAAGG
TATATTTCTCAGCATTTATGGCGGCTTATAAAGCGATGATGGCTATATCTGATTGTGAAACCTTGATTGAAGCACAGCCA
ATACCTGCTTATTTTTCGCGTCGCGTTGTGATGTTTGAAAGAATGTGTAGCACTGGTATGGTTTTCTCCAAAGTTTTGAA
AGAAGGAAAATAG