Details for Kale Locus Bo5g123220

Position : C5 ( 5`- 37639659 .. 37641940 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g123220

Protein [Map View]
MAMAMANLARRKAYLLTRNISTAPLRSSFSLSRGFASSGSDENDVVIIGGGPGGYVAAIKAAQLGLKTTCIEKRGALGGT
CLNVGCIPSKALLHSSHMYHEAKHVFANHGVKVSSVEVDLPAMLAQKDTAVKNLTRGIEGLFKKNKVNYVKGYGKFLSPS
EVSVETTDGETTVVKGKHIIVATGSDVKSLPGITIDEKKIVSSTGALSLTEIPKKLIVIGAGYIGLEMGSVWGRLGSEVT
VVEFASDIVPSMDGEIRKQFQRSLEKQKMKFMLKTKVVGVDSSGDGVKLIVEPAEGGDQTTLEADVVLVSAGRSPFTSGL
DLDKIGVETDKIGRILVNERFSTNVSGVYAIGDVIPGPMLAHKAEEDGVACVEFIAGKHGHVDYDKVPGVVYTYPEVASV
GKTEEQLKKDGVSYRVGKFPFMANSRAKAIDTAEGLVKILADKETDKILGVHIMSPNAGELIHEAVLAINYDASSEDIAR
VCHAHPTMSEAIKEAAMATYDKPIHM*

DNA
ATGGCGATGGCGATGGCGAACTTGGCTAGGAGAAAGGCTTACCTTCTCACAAGAAACATCTCCACTGCCCCTCTCAGATC
CTCCTTCTCCCTCTCCCGCGGCTTCGCTTCGTCCGGATCCGACGAAAACGACGTCGTCATCATCGGCGGGGGTCCTGGAG
GTTACGTGGCGGCGATTAAGGCCGCACAGCTCGGTCTCAAAACGACCTGCATCGAAAAACGCGGCGCTCTCGGTGGTACT
TGTCTCAACGTCGGATGTATTCCTTCAAAGGCTCTTCTTCACTCTTCCCACATGTACCACGAAGCAAAGCACGTTTTTGC
TAACCATGGCGTTAAGGTCTCTTCCGTTGAAGTCGATCTCCCTGCTATGCTAGCTCAGAAAGACACAGCCGTCAAGAATC
TCACCCGCGGTATCGAAGGCCTCTTCAAGAAGAACAAGGTGAACTACGTTAAAGGCTATGGCAAGTTCCTCTCCCCGTCT
GAAGTCTCTGTGGAGACAACCGATGGAGAAACCACCGTTGTGAAAGGGAAGCATATCATCGTCGCAACTGGCTCGGATGT
CAAGTCTTTGCCCGGCATCACCATCGATGAAAAGAAGATTGTCTCATCGACAGGAGCACTGTCTCTGACCGAGATACCGA
AGAAACTGATCGTCATTGGCGCTGGCTACATCGGTCTCGAGATGGGTTCTGTCTGGGGAAGGCTCGGATCTGAGGTCACA
GTTGTTGAGTTTGCGTCAGATATTGTGCCCTCGATGGATGGTGAAATCCGCAAGCAGTTTCAACGTTCGCTAGAGAAGCA
GAAGATGAAGTTCATGCTCAAGACTAAAGTCGTTGGCGTGGATTCATCAGGAGATGGCGTCAAGCTCATAGTGGAGCCTG
CAGAAGGTGGAGACCAGACCACTCTCGAAGCTGATGTTGTCCTCGTGTCAGCAGGAAGATCTCCCTTCACATCTGGACTT
GATCTTGACAAAATCGGAGTCGAAACTGACAAAATCGGGAGGATCCTCGTGAACGAGAGGTTCTCAACCAACGTTTCAGG
CGTTTATGCTATTGGAGATGTGATTCCAGGACCAATGCTGGCTCACAAAGCCGAAGAAGACGGTGTGGCTTGTGTTGAGT
TTATAGCAGGCAAACACGGACACGTGGATTACGACAAGGTCCCTGGCGTTGTCTACACATACCCCGAAGTTGCATCTGTG
GGTAAAACCGAGGAGCAGCTGAAGAAAGACGGTGTGAGCTACCGAGTTGGGAAGTTCCCGTTCATGGCTAATAGCAGAGC
CAAGGCTATCGATACAGCAGAGGGATTGGTCAAGATTTTGGCTGATAAAGAGACGGACAAGATCTTGGGAGTTCACATTA
TGTCGCCAAACGCGGGAGAGTTGATCCACGAGGCGGTTCTGGCGATTAACTACGATGCGTCTAGTGAAGACATTGCTAGA
GTCTGTCACGCTCATCCCACCATGAGTGAGGCTATCAAGGAAGCTGCTATGGCTACCTACGACAAGCCTATTCACATGTA
G