Details for Kale Locus Bo5g123210

Position : C5 ( 5`- 37637363 .. 37638831 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g123210

Protein [Map View]
MRTSRASSVTKKWLLFSQLCLLKDLVIRCVRQFIRRAKAMLLSQNVVVEAAEISVVVDVKSSQQDLNSFQIAQVRIRDSV
CIEIPVPEETPLLGSVKTCSVAEEDVTEFVPKISSGSYADKGSREYMEDEHICIDDLSSHLASSFFRFPVPVAFYGVFDG
HGGSEASQYIKENATRLFFEDDVFRESHFVLNNFFLQEVERSHREAYRLADLAMEDESIVSGSCGTTALTALVIGRHLMV
ANVGDCRAVLCRKGKAVDMSFDHKSTFEAERRRVEELGGYFEEEYIYGELAVTRALGDWSLKRYSSLGGSLSPLISDPEI
KQMVLTEEDEFLIMGCDGVWDVMTSQYAVTFARQGLRRHGDPRRCAMELGREAFRLDSADNVTVLVICFTSSSTTPQRRK
IQFCVSDEARAKLQTMLQG*

DNA
ATGCGTACAAGCAGAGCTTCTTCAGTCACCAAAAAATGGCTGCTTTTCTCACAGCTTTGTCTTCTGAAGGATCTCGTAAT
CAGATGCGTACGTCAGTTCATCAGAAGAGCTAAAGCGATGCTTCTGAGTCAAAACGTCGTCGTCGAAGCTGCTGAGATCA
GTGTCGTCGTCGACGTTAAGTCATCTCAACAAGATCTCAATAGCTTTCAGATTGCTCAAGTTCGAATCCGTGACTCTGTT
TGTATCGAGATTCCCGTTCCCGAAGAAACGCCCTTGTTAGGATCGGTGAAGACTTGTTCTGTAGCTGAAGAGGATGTTAC
TGAGTTTGTCCCCAAGATAAGTTCTGGGAGTTATGCGGATAAAGGCTCGAGGGAGTACATGGAAGATGAACACATATGCA
TAGACGATCTTTCATCTCATCTCGCCTCTTCCTTCTTCAGATTCCCTGTTCCCGTTGCTTTCTACGGTGTGTTTGATGGC
CATGGTGGATCTGAAGCTTCTCAGTATATTAAAGAGAATGCGACAAGATTGTTCTTTGAAGACGATGTGTTTAGAGAGTC
TCACTTTGTTCTGAACAACTTTTTCTTGCAAGAAGTTGAGAGATCTCACCGGGAAGCTTATAGGTTAGCTGATCTCGCCA
TGGAAGATGAAAGCATTGTTAGTGGTTCGTGCGGAACAACCGCATTGACAGCTCTTGTGATCGGACGGCACTTGATGGTT
GCTAACGTAGGTGATTGCCGTGCGGTGCTATGCAGGAAAGGGAAAGCTGTTGATATGTCGTTTGATCATAAGTCTACGTT
TGAGGCGGAGCGGAGACGGGTGGAGGAGTTAGGAGGGTACTTTGAAGAGGAGTATATATACGGTGAACTCGCGGTTACAA
GAGCACTTGGAGACTGGTCACTGAAGAGGTACTCTTCCTTGGGAGGTTCTTTGTCGCCTCTGATCTCAGACCCGGAGATT
AAGCAGATGGTTTTGACGGAGGAAGATGAGTTTTTGATAATGGGATGTGACGGTGTTTGGGACGTGATGACAAGTCAGTA
TGCTGTTACGTTTGCCAGGCAAGGGCTGAGGAGACATGGGGACCCGAGGAGATGTGCGATGGAACTTGGAAGGGAAGCGT
TCAGGCTTGACTCGGCGGATAATGTTACAGTGTTGGTCATCTGCTTCACGTCTTCGTCCACAACCCCTCAGAGGAGAAAA
ATACAGTTTTGTGTTTCTGATGAAGCCAGAGCCAAATTACAGACGATGCTGCAAGGCTAA