Details for Kale Locus Bo5g123160

Position : C5 ( 5`- 37614090 .. 37617262 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g123160

Protein [Map View]
MGNFRRGEGGGGSSGHDRNEHMVFPKPETIDFDLPCDTSYPQQFGDNAASSSGSNVKSLLIEMGFCPTLVQKAIDENGED
DLELLLEILTKSSVTEHPEPSFHGLMEPKPEPDTEYEADGKRMALLGMKFPENLVDFALDRLGKDAQIDVMVDFIVAAQL
AEKFAEESDESLDDTEINEDDEDVIPVASRGPEVPNEVLFETMDKTLHLLEMGFSNHEISIAIEKIGTEGQISDLAETIV
TGEAPGLIPNDLEEIEKKVSAAPAATCLSKSWRFLGVGAEKVDSGRGSSSGTADIKPDPSTDPLPFSTTANVGETSRGKR
LKDEDDNAFLDEFSDFDDRGKRPRPEYMETPWMQDDKDNTYGFSRAMQPRLSQTLSPDVATRPYFFYGNLSEISPRWCSK
ISGYLFGIHPEHVDTRLCSALRRTEGYVHNLPVENRFNILPTPRLTVQDAMPHMKSWWPQWDVRKHLSSVACSDLDYATT
LCERLGRRLAECKGKPSQQDQTIILRHCHTSNLIWIAPNILSPVEPEHLECIMGYPTNHTKIGGARYAERLKLFEFCFQT
DTLGYHLSVLKSLFPEGLTVLSLFSGIGGAEITLNRLGIHLKNVVSVEHCGLSRNILKRWWQSSGQTGELVQIEAIRSLS
TNKLEALVERFGGFDFVICQNPPIPPDLSKETGSNEARDFDYSLFNEFVRVTKRVIHVMASS*

DNA
ATGGGTAATTTTCGTAGAGGAGAAGGAGGTGGAGGTTCCTCTGGTCATGACAGGAATGAACATATGGTGTTCCCAAAACC
AGAGACCATAGATTTCGACTTGCCCTGCGACACTTCTTATCCTCAGCAGTTTGGTGACAATGCTGCTAGTTCTTCTGGAA
GTAATGTGAAGTCATTGCTGATTGAGATGGGTTTTTGCCCTACTCTTGTTCAGAAAGCTATTGATGAAAATGGTGAAGAT
GATCTTGAGTTGTTATTAGAGATTCTCACTAAGAGTTCTGTAACTGAACATCCTGAACCCAGCTTTCATGGACTAATGGA
ACCCAAACCGGAGCCTGATACTGAATATGAAGCCGATGGCAAAAGGATGGCGTTACTAGGAATGAAGTTCCCGGAAAATC
TAGTTGATTTTGCACTAGACAGACTTGGTAAAGACGCTCAAATTGATGTGATGGTGGACTTCATTGTTGCTGCTCAACTA
GCAGAAAAGTTTGCAGAAGAGTCTGATGAATCGCTTGATGACACTGAAATCAATGAAGACGATGAAGATGTCATTCCAGT
TGCTTCCAGAGGACCTGAGGTTCCCAATGAAGTATTGTTTGAAACAATGGACAAAACTTTGCATCTACTGGAAATGGGAT
TCTCTAACCATGAAATCTCAATAGCAATTGAGAAGATAGGTACGGAAGGTCAAATTTCTGACCTCGCTGAGACAATTGTT
ACTGGTGAAGCTCCTGGTCTCATTCCTAATGACCTTGAAGAAATAGAAAAAAAAGTTTCAGCGGCTCCTGCAGCTACATG
TCTTTCAAAGAGTTGGAGATTTCTTGGTGTTGGTGCAGAGAAAGTAGACAGTGGTAGAGGTTCCTCAAGTGGCACTGCTG
ATATAAAACCAGATCCTAGTACTGACCCTCTTCCTTTCTCCACCACTGCCAATGTGGGAGAGACCTCAAGGGGTAAAAGA
CTAAAAGATGAAGATGACAATGCCTTTCTAGACGAATTTTCTGACTTCGATGACAGAGGCAAAAGGCCAAGACCCGAATA
TATGGAAACCCCTTGGATGCAAGATGATAAAGATAACACATATGGATTCTCAAGGGCAATGCAGCCACGTTTATCCCAAA
CGCTTAGCCCCGATGTAGCAACACGACCTTATTTCTTCTACGGAAACCTAAGTGAAATCTCTCCAAGGTGGTGTTCTAAG
ATCTCGGGTTACTTGTTCGGAATCCACCCTGAGCATGTAGATACTCGGTTGTGTTCAGCTCTCCGCAGGACAGAAGGGTA
CGTGCACAATCTTCCCGTTGAAAACAGGTTCAACATCCTCCCAACGCCAAGGTTAACTGTACAAGACGCAATGCCACACA
TGAAGAGCTGGTGGCCACAATGGGATGTGAGAAAGCATCTGAGTAGCGTTGCATGTTCTGATTTAGATTATGCAACTACT
CTTTGTGAAAGACTTGGACGTCGTCTAGCTGAATGCAAGGGAAAGCCATCTCAGCAAGACCAGACTATAATACTCCGACA
CTGTCACACCTCTAATCTTATCTGGATTGCTCCCAACATCCTCTCACCTGTAGAGCCTGAGCATCTAGAGTGCATCATGG
GATACCCAACAAACCACACCAAGATCGGTGGTGCGAGATATGCTGAGAGGTTGAAGCTGTTTGAGTTCTGTTTCCAGACA
GACACATTGGGTTACCATCTCTCTGTGCTCAAGTCCTTGTTTCCTGAAGGGTTAACAGTTTTATCGCTCTTTAGCGGGAT
CGGTGGTGCGGAGATCACGTTAAACCGCCTTGGAATCCATCTCAAAAACGTGGTCTCTGTTGAGCACTGTGGACTGAGCC
GTAACATACTGAAACGATGGTGGCAGAGTTCAGGACAAACCGGAGAGCTTGTGCAGATCGAAGCGATTAGGAGCTTAAGT
ACAAATAAGCTTGAGGCTTTGGTGGAGAGATTCGGTGGGTTCGACTTTGTCATTTGTCAGAACCCACCAATACCACCTGA
TCTGTCGAAAGAAACCGGGAGTAACGAAGCTCGTGATTTTGATTACTCTTTGTTTAATGAGTTTGTTCGAGTCACAAAAC
GTGTCATACATGTCATGGCGTCAAGCTGA