Details for Kale Locus Bo5g123120

Position : C5 ( 5`- 37596263 .. 37597623 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g123120

Protein [Map View]
MMSRLLFFFVFLYTVTTLTSTTSGACQTSCGSIQINYPFGIDKGCGSPQFQGMLNCSSTDLYFITPSGGYKVRSIDYDKN
TMVVFDPLMSTCSTLQPHHDFKLSDIQNAIIRPSYDTVFALFNCSSDSPVQNRYKSLCFEAAGHSCDELYSSCTSFGIFN
TTSGNNTASLGNSTVSATPYCCFTSYDTVRVMSMNILDCSHYTTVIDDGKMRGVTPVDWSYGIELSYSVPEIGCDRCRKS
GGTCGFDAETQIFLCQCSNNTSPRDCGGVSDKGGCNSRSTNYAMLLLGMLVSFICAIL*

DNA
ATGATGTCGAGGCTCTTATTCTTCTTTGTCTTCCTCTACACAGTAACAACTCTAACATCAACAACCTCAGGAGCTTGCCA
AACATCCTGCGGCAGCATCCAAATAAACTACCCGTTCGGTATTGACAAAGGTTGCGGATCTCCACAGTTCCAAGGAATGC
TCAACTGCTCCTCCACCGATCTGTATTTCATCACTCCTTCCGGAGGCTACAAGGTACGGTCAATCGACTACGACAAGAAC
ACGATGGTTGTCTTCGATCCGTTAATGTCCACTTGCTCCACCCTCCAGCCTCACCACGATTTCAAACTCTCGGATATCCA
GAACGCTATTATAAGACCCTCGTACGACACCGTTTTCGCTCTCTTCAACTGCTCCAGTGACTCTCCGGTTCAGAATCGGT
ACAAGAGTCTCTGCTTCGAAGCCGCCGGCCACTCCTGCGACGAGCTTTATAGCTCGTGTACTTCCTTTGGCATCTTCAAC
ACTACTTCTGGTAACAATACGGCGTCGCTAGGTAACAGTACGGTGAGTGCGACGCCGTATTGTTGTTTCACGAGCTACGA
TACGGTTCGTGTGATGAGTATGAACATCTTGGACTGTTCACATTACACGACGGTGATTGACGATGGAAAAATGAGAGGTG
TGACGCCTGTGGATTGGTCGTATGGAATCGAGCTTTCGTACTCGGTGCCGGAGATTGGTTGCGACCGTTGCCGGAAGTCA
GGCGGCACGTGTGGTTTCGACGCCGAGACGCAGATCTTTCTTTGCCAGTGTTCCAACAACACTTCTCCACGAGATTGTGG
TGGTGTGAGTGACAAAGGAGGTTGCAACTCTAGAAGCACTAATTATGCTATGCTTTTGTTGGGGATGCTCGTATCTTTTA
TTTGCGCAATCTTATGA