Details for Kale Locus Bo5g123110

Position : C5 ( 5`- 37582307 .. 37592282 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g123110

Protein [Map View]
MPRNAPRIEMPESEENEFASFSMFSPSRAPLNSIPDPSQLQKTTHLSDFDLAQKLELARTQGPERRFEGRAGAHDSNPRI
VTRNARSRSEPNSAQSTPTRSGARVSLGGGCVTGARVAQSFAGRGRIPKWISMADSMETTPHFEMNEDHSFWKEHNVQVL
IRMRPISTMERATQGHGRCLKQESPQTLVWLGHPETRFTFDHVASETISQLPEYTLWMCILLIFQEKLFRVAGLPMVENC
LSGYNSCVFAYGQTGSGKTYTMMGEISEVEGSLGEDCGVTARIFEYLFSRIKMEEEGRRDEKLRFSCKCSFLEIYNEQIT
DLLEPSSTNLQLREDLGKGVYVENLVEHNGAANRKIAATHMNSESSRSHSVFTCTIESIWERDSLTHSRFARLNLVDLAG
SERQKSSGAEGDRLKEAANINKSLSTLGLVIMSLVDLAHGKHRHVPYRDSRLTFLLQDSLGGNSKTMIIANVSPSLCSIN
ETLSTLKFAQRAKLIQNNVVCDYSSITTSSMKLDLTQVCFIFMFQAKVNEDASGDVTALQQEIRKLKVQLSSLMKNHNSC
GALTDCIASLEEPRYSGTCEVARKTQQDKCHCQVNNSLRMKVKNTKDILIGALRRENIAETALQKSEAEIERIDSLVRDM
EEDAKCIKRMLNLQQEKVGETEFSTSDSLMTNECLIEENKSLKGEINLLREIMDKNPQLKRSTLENTKLREQLLRYQKFY
DHGEREALLSEMTGLRDQLLDVLEAKDESFSNHENEVEKELKDCRKMNSSFVRELDEIQARVGRYMKFDQTQSDFVRYQT
DRGVVVIKFASPVASTISGAEQVNQAHKHSTVETMSAIGENKEEVAFSESKNSSNIYGESDNPDGIRVWVINESQDVLEE
NDRSIKLLNNKSSMERDAVPRIEGQDLELSGMVNNTDAVMKADEGTDRSVLQFKLRKVIKDLEEAKTLNSQYEKEQKLLL
SQQQDIEVVREQVETETARTILELQEEVIALQSEFEGRICKLTEENQSMKDAITAREAEIRALNQDWEKATLELTNFIVD
GSKSITDASTQIESIVCSFPHVNAWIGDYVEKAAKDCIRKEETILLLHKSLEDARILLAEMDLKLNCLKGAAIALNEFQL
DGNAATTEESFRVSTGLDRISNEVDTLENDLNAKQCSILEAERHAEAAISVKKWLSDSRNQHQVPEKVENQSVKESRPSS
SVLASPSAEGNADINFSMDGYISEATYTKGDELSTSSSDFSNCRLQHDCALKAEGQGGSASESDAQEIHNRTTSAALLVK
SGSEDCVYCGEGRQTLQRPLTITMGRSETERKCSNPRVDPVRSFFDRFEAVSATMKEVDLTLCELVKANEKSKFVTGMCL
QTHEEQMVKEKNLLDDLEQVKSTLLAKEQESQILLNQTQSTLADMEKSVSLLEECLLETKREVGETVEALVSDVEQIVSE
NMEREFTMYATYQCHIGKLMDQILDHRKHVITPRVAGQENQQSMETKAIGYSAEDEVTGKLNRVHKADVVTGFEGEEVVQ
THEGLLNENFYLKKELERKEALFEGLLFDFRLLQESASNKRDIRDEMDELFDALCKVQKDLEVKANQVQALFVHNENLEN
CCINLKKALLTSKADLEQANESIQVLEEQNDELNVLVRDLCMEKVAAEEGLEEQKELVQRLENEILHLTTTAEKQLVKSI
EENLRKTSDEKDQLVEEICSLNDKLKLAYAIADEKEAIAVEARQESEASKIYAEQKEEEVKILEISVEELERTVNILERR
VYDMDEEVKRHRTLETELQALRQRLFRFEDLTGTVVTTTEGRDEYESQLSTSKELQGAHGQIQVLQKEVAEQTKEIKQLK
EYISEILLHSEAQASNYQEKYKTLEVMIRNFKLEDSNSSAAETAISHKTDKSSTRSRGSSSPFRCIVGLVQQMKLEKDQE
LTMARVRVEELESLLAAKQKEVCTLNTRLAAADSMTHDVIRDLLGVKMDITSYAELIDQHQIQRVVEEAKQHAEEIMSKD
QEIINLKRHIDALVKERERLALFYFYHNCSITSQFPYFSLLKYSKEKGNLAFQTKEILTKFCSRGMFLLDSCMSELNKKD
TDVLATQISLDQLQERAQLLSMQNEMLKNDKSNLLRKLAELERTVREAGASNQRVPQTKKDTVSFKLADTDYTKRLENAQ
KLLSHANNELAKYRKTSSNIPSTRTQGQSSGTRYR*

DNA
ATGCCCCGTAACGCTCCGAGAATCGAGATGCCGGAATCTGAAGAGAACGAGTTCGCGAGCTTCTCTATGTTCTCCCCTTC
ACGAGCTCCTCTGAATTCGATACCAGATCCAAGTCAATTACAGAAGACGACTCATCTCTCCGATTTCGATTTGGCTCAGA
AACTGGAACTCGCGAGAACGCAGGGTCCGGAGAGGAGATTCGAAGGTAGAGCTGGTGCGCACGATTCGAACCCTAGGATC
GTAACTCGTAATGCGAGATCTAGGTCGGAGCCAAACTCCGCGCAGAGTACGCCGACTAGGAGCGGTGCTAGGGTTTCTCT
AGGCGGCGGTTGTGTTACCGGCGCGAGAGTTGCTCAGTCTTTCGCTGGAAGAGGAAGGATCCCAAAGTGGATTTCTATGG
CTGATTCTATGGAAACAACTCCACATTTTGAGATGAATGAAGATCATTCGTTCTGGAAAGAGCACAATGTGCAGGTTTTG
ATAAGGATGAGGCCAATAAGCACAATGGAAAGAGCTACTCAAGGACATGGTAGGTGTTTAAAGCAGGAGAGTCCACAGAC
ATTGGTTTGGTTAGGCCATCCAGAGACCAGATTCACCTTTGACCATGTTGCCAGTGAGACTATCTCTCAGTTACCTGAAT
ACACCTTATGGATGTGTATCCTGCTGATTTTTCAGGAGAAACTATTTCGCGTTGCTGGGCTGCCTATGGTGGAGAATTGT
TTGTCTGGTTACAACAGCTGTGTGTTCGCCTACGGCCAGACTGGTAGTGGCAAGACCTATACTATGATGGGAGAGATATC
TGAGGTAGAGGGAAGCCTCGGTGAAGACTGTGGAGTTACTGCTCGTATTTTTGAATACCTCTTCTCAAGAATCAAAATGG
AAGAAGAGGGAAGGAGAGATGAAAAACTTAGATTCAGTTGCAAATGTTCTTTTCTTGAGATATACAACGAGCAGATTACC
GACCTCTTGGAGCCATCCTCGACCAATTTGCAACTCAGAGAAGACTTAGGAAAAGGAGTATATGTGGAAAATCTTGTAGA
ACATAATGGAGCTGCGAACCGGAAGATTGCAGCTACTCATATGAATAGTGAAAGCAGCAGATCCCACAGCGTTTTCACGT
GTACAATCGAGAGCATCTGGGAGAGAGATTCCCTAACCCATTCAAGATTTGCCAGACTAAATTTGGTCGATTTGGCTGGT
TCTGAAAGGCAGAAAAGCTCAGGCGCGGAAGGTGATCGCCTAAAAGAAGCAGCAAACATTAACAAATCCTTATCCACTCT
GGGCTTAGTGATAATGTCTCTGGTGGATTTGGCACATGGCAAACATAGACATGTTCCGTATCGAGATTCACGACTTACCT
TTCTACTGCAGGATTCTCTTGGGGGTAATTCTAAAACAATGATAATAGCCAATGTCAGCCCATCTCTTTGCTCTATAAAC
GAGACCCTCAGCACACTGAAATTCGCACAACGAGCCAAACTTATCCAGAATAACGTAGTTTGTGATTATTCAAGTATTAC
AACTTCGTCTATGAAGTTAGACTTGACGCAAGTTTGCTTCATTTTCATGTTCCAGGCTAAAGTCAACGAAGATGCCTCTG
GGGATGTCACAGCACTCCAGCAGGAAATAAGAAAGTTAAAGGTCCAACTGTCCTCTCTCATGAAGAACCATAACTCTTGT
GGAGCTCTTACAGACTGCATAGCTTCTCTTGAAGAACCCAGATACTCTGGTACATGTGAAGTAGCAAGAAAAACACAACA
AGACAAGTGTCACTGTCAGGTGAACAACTCACTGAGAATGAAGGTGAAAAATACGAAAGATATTTTGATTGGTGCTCTCA
GAAGAGAAAATATTGCTGAAACTGCCCTTCAGAAGTCTGAGGCTGAGATTGAGCGTATAGACAGCTTGGTTAGAGATATG
GAAGAGGATGCTAAATGCATTAAAAGAATGCTTAATCTTCAGCAAGAAAAAGTTGGAGAGACGGAATTCTCTACGTCTGA
TTCTTTGATGACAAATGAGTGTCTCATTGAAGAAAATAAATCTCTGAAAGGAGAGATCAATCTTCTTCGTGAAATCATGG
ACAAAAACCCACAGTTGAAACGTTCGACCTTGGAGAACACCAAACTCCGGGAGCAGCTACTACGATATCAGAAGTTTTAT
GACCATGGGGAGCGAGAGGCATTGCTGTCTGAAATGACAGGACTTCGCGACCAGCTTCTTGATGTTCTTGAAGCAAAAGA
TGAGTCCTTTTCAAATCATGAGAACGAAGTGGAAAAGGAATTGAAAGACTGCAGAAAGATGAACTCTAGCTTCGTCAGAG
AACTAGATGAGATACAAGCAAGAGTTGGAAGATATATGAAATTCGACCAAACTCAATCCGACTTTGTAAGATATCAGACT
GACAGAGGAGTGGTTGTTATAAAATTTGCTTCGCCGGTTGCATCTACCATCAGTGGAGCTGAGCAGGTTAATCAAGCACA
TAAGCATTCAACGGTAGAAACAATGTCTGCTATCGGTGAAAACAAAGAGGAAGTGGCCTTTTCAGAGAGTAAAAACTCAA
GTAATATCTATGGTGAATCAGACAATCCTGATGGCATTAGGGTTTGGGTAATAAATGAATCACAGGATGTGCTAGAGGAG
AACGATAGATCCATCAAACTGCTGAACAACAAAAGTAGTATGGAAAGAGATGCTGTTCCTAGGATAGAAGGTCAAGACTT
GGAGTTAAGCGGCATGGTCAATAACACAGATGCTGTAATGAAGGCTGATGAGGGGACAGACAGGTCAGTCCTGCAGTTCA
AGTTAAGGAAAGTAATTAAGGACCTCGAGGAGGCCAAAACACTCAATAGTCAGTATGAAAAAGAGCAGAAGTTACTTTTA
TCTCAGCAACAAGATATTGAAGTGGTCCGCGAGCAAGTCGAGACAGAAACTGCTAGAACAATTCTTGAGCTGCAGGAAGA
GGTGATTGCTCTCCAGTCTGAATTTGAAGGAAGAATCTGTAAATTGACCGAAGAAAATCAATCGATGAAAGATGCTATAA
CTGCTAGAGAGGCAGAAATAAGAGCACTTAACCAAGACTGGGAAAAGGCCACCTTAGAACTAACAAATTTCATTGTGGAT
GGGTCTAAATCCATCACAGATGCCTCCACACAGATTGAAAGTATTGTATGTTCGTTTCCACATGTGAATGCATGGATAGG
AGATTATGTTGAAAAGGCTGCAAAAGATTGCATAAGAAAGGAAGAAACAATTTTACTTCTTCACAAAAGCTTGGAGGATG
CAAGGATATTGTTAGCAGAGATGGATTTGAAGCTGAATTGCTTAAAGGGTGCAGCAATTGCTCTCAACGAATTTCAACTG
GATGGCAATGCTGCAACCACCGAAGAGAGTTTCCGCGTGAGCACTGGATTAGACAGGATTAGCAACGAGGTAGACACGCT
TGAGAATGACTTAAATGCAAAGCAGTGTTCTATTCTAGAGGCAGAGCGACATGCTGAGGCTGCAATTTCTGTTAAAAAAT
GGCTTTCTGACTCTAGAAATCAACACCAAGTGCCGGAAAAAGTAGAAAATCAATCGGTCAAAGAAAGCCGCCCCTCAAGT
TCAGTCTTGGCTTCTCCTAGTGCGGAAGGGAATGCTGATATTAATTTTTCAATGGATGGATATATAAGTGAAGCAACATA
TACGAAGGGTGATGAGCTTTCAACATCAAGCTCTGACTTTTCAAACTGCAGATTGCAACATGATTGTGCATTGAAGGCAG
AGGGCCAAGGAGGTTCAGCTTCTGAATCTGACGCCCAGGAAATTCATAACAGGACCACATCAGCAGCTTTGTTGGTCAAG
AGTGGTTCTGAAGATTGTGTTTACTGCGGAGAGGGAAGGCAGACTCTACAGAGGCCATTAACGATAACGATGGGTAGATC
AGAAACGGAACGCAAATGCAGTAACCCAAGGGTGGATCCTGTGAGAAGCTTCTTCGATCGATTTGAGGCAGTTAGTGCTA
CCATGAAAGAAGTTGATCTCACACTATGTGAATTAGTAAAGGCCAACGAAAAATCAAAATTTGTAACTGGAATGTGCCTT
CAAACGCATGAAGAGCAAATGGTTAAGGAGAAAAATCTGTTGGATGATCTTGAACAGGTGAAGTCTACGCTATTGGCAAA
AGAACAGGAAAGTCAAATCTTGCTAAATCAAACACAATCGACTTTGGCTGACATGGAAAAGTCAGTGTCTTTGCTTGAAG
AATGTCTTCTGGAAACGAAAAGAGAAGTAGGAGAAACAGTAGAGGCTTTAGTTTCCGATGTTGAACAGATTGTATCTGAA
AACATGGAGAGAGAGTTCACCATGTATGCAACATATCAGTGCCACATTGGGAAACTGATGGATCAAATTTTGGACCACAG
AAAACATGTTATCACTCCCCGCGTTGCGGGGCAAGAAAACCAACAGTCAATGGAAACGAAGGCCATTGGGTACAGTGCTG
AAGATGAAGTTACAGGAAAGCTAAATAGAGTTCACAAAGCTGATGTGGTCACAGGTTTCGAAGGTGAAGAAGTTGTTCAA
ACACATGAAGGCCTGTTAAATGAGAACTTTTATCTGAAAAAGGAGCTGGAGAGAAAAGAAGCTTTGTTTGAAGGTTTGCT
TTTTGATTTTCGGCTACTCCAGGAATCAGCATCAAATAAAAGAGATATCAGAGATGAAATGGATGAGCTGTTTGACGCGT
TATGCAAAGTTCAGAAAGATTTGGAGGTGAAAGCGAATCAAGTTCAAGCTCTTTTTGTTCATAATGAGAATCTCGAAAAT
TGCTGCATTAACTTGAAAAAGGCTCTTCTTACGTCGAAGGCAGATCTAGAGCAGGCCAACGAGAGCATACAAGTTCTTGA
GGAGCAGAATGATGAGTTAAACGTCCTCGTCAGAGACCTCTGTATGGAAAAGGTTGCAGCTGAAGAGGGATTGGAAGAAC
AAAAAGAGCTTGTCCAAAGGTTAGAAAACGAAATCCTTCACTTGACTACTACAGCAGAAAAGCAGTTGGTCAAATCCATC
GAAGAAAACTTGAGAAAAACCAGCGATGAGAAAGATCAACTTGTTGAGGAAATATGTTCATTGAATGATAAGCTCAAGTT
GGCGTATGCTATAGCTGATGAAAAAGAAGCAATTGCGGTAGAGGCTCGCCAGGAATCTGAAGCGAGTAAAATATATGCGG
AACAAAAGGAAGAAGAGGTCAAGATTCTAGAAATTTCTGTTGAGGAACTTGAGCGTACTGTAAATATATTAGAACGACGG
GTGTATGATATGGATGAGGAAGTTAAAAGGCATCGCACATTAGAGACAGAGCTCCAAGCTCTCAGGCAGAGATTGTTTAG
ATTTGAGGACCTCACTGGCACTGTGGTCACAACCACTGAAGGCAGAGATGAATATGAGAGTCAACTATCCACGTCAAAAG
AGCTGCAAGGTGCGCATGGTCAGATACAAGTCCTCCAGAAAGAAGTAGCAGAACAAACCAAAGAGATTAAACAGCTAAAA
GAGTACATCTCCGAAATTTTACTGCATTCGGAGGCCCAAGCATCTAATTACCAGGAGAAGTATAAGACTCTGGAGGTCAT
GATTCGAAACTTCAAATTAGAGGACTCGAATTCGTCAGCTGCAGAGACCGCCATATCACATAAAACTGACAAAAGCTCAA
CAAGGAGCAGAGGTTCAAGTTCACCCTTTAGATGTATAGTTGGGTTGGTACAACAGATGAAGTTGGAGAAGGATCAGGAA
TTGACCATGGCAAGAGTTCGTGTTGAAGAATTGGAGTCACTGCTAGCTGCTAAACAGAAAGAGGTTTGCACATTGAACAC
GAGATTAGCTGCAGCTGATAGCATGACTCATGATGTTATTCGAGATTTACTTGGTGTGAAAATGGATATAACTAGCTATG
CTGAGTTGATTGACCAGCACCAGATCCAAAGAGTGGTTGAAGAGGCTAAGCAACATGCTGAAGAGATCATGTCCAAGGAC
CAAGAAATCATCAACCTGAAGAGACATATAGATGCTCTTGTTAAGGAAAGAGAGAGGTTAGCGCTGTTCTACTTCTACCA
TAACTGTTCTATCACTAGCCAATTTCCTTATTTTTCTCTCTTGAAGTACTCAAAAGAAAAAGGTAATTTAGCGTTTCAAA
CAAAAGAGATTCTTACCAAGTTTTGCTCTCGTGGGATGTTCCTACTGGACAGTTGCATGTCAGAGTTGAACAAGAAGGAT
ACAGATGTTCTTGCGACACAGATATCTTTGGACCAATTACAAGAGCGAGCTCAGTTGCTTTCTATGCAAAACGAAATGTT
GAAGAATGACAAGAGCAATTTGCTGAGGAAGTTAGCTGAACTTGAACGAACAGTCCGCGAGGCAGGAGCCAGTAACCAAC
GTGTTCCACAGACAAAAAAGGATACAGTGTCATTTAAACTTGCTGATACTGATTATACCAAGAGACTGGAAAATGCTCAG
AAGCTTCTTTCTCATGCTAACAATGAATTGGCAAAGTATCGCAAAACCAGCAGTAATATTCCATCTACAAGAACTCAAGG
ACAGAGCTCTGGTACAAGATATCGGTAA