Details for Kale Locus Bo5g123080

Position : C5 ( 5`- 37561936 .. 37563739 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g123080

Protein [Map View]
MIHMGFSGFVAFLLIRVFKVVAPVKMTFQIYATCVVPISAFFASSLWFGITAYLHISVAFIQMLKALIATFIMAVIRGTD
KPRCDVFSNMLLVSVGVVISSYGEIHFNVVGTVYQVTGIFAEALRLVLTQVLLQKKGLTLNPINSLYYIAPCSFPLVCVG
ETHDGMIGRTGAVTIRVAGVLKDWILIALSTVIFPESTITGLNIIGYAIALCGVVMYNYIKVRDVKASQLTADSLPDRIN
KEWKMEKKSSDKFNPDVGGESQE*

DNA
ATGATCCATATGGGGTTCTCTGGATTTGTGGCCTTCCTTCTTATTCGCGTGTTCAAGGTTGTAGCTCCGGTTAAAATGAC
ATTTCAAATATACGCAACATGTGTTGTACCTATAAGCGCATTCTTTGCATCAAGCCTGTGGTTTGGCATTACTGCATACT
TGCACATTTCTGTTGCCTTCATTCAGATGCTCAAAGCTCTAATAGCAACGTTTATCATGGCAGTTATTCGCGGCACTGAC
AAACCAAGGTGCGACGTGTTCTCCAACATGTTGCTGGTCAGTGTTGGAGTTGTTATATCTTCTTACGGAGAAATCCATTT
CAATGTAGTTGGGACGGTCTATCAGGTCACAGGCATCTTTGCTGAAGCACTTAGACTGGTGCTAACTCAAGTTCTTCTCC
AGAAGAAAGGGTTGACATTAAACCCTATTAACAGCTTATATTACATAGCTCCCTGCAGCTTTCCCTTGGTATGTGTTGGA
GAAACCCACGATGGAATGATAGGGAGAACAGGGGCAGTAACTATACGAGTAGCTGGTGTTCTCAAAGACTGGATTCTCAT
AGCACTCTCCACTGTCATTTTTCCTGAGTCAACCATCACTGGACTGAACATTATTGGATACGCAATTGCGCTATGTGGTG
TTGTCATGTACAATTACATAAAAGTAAGGGACGTGAAGGCGTCTCAATTAACTGCCGACAGTCTCCCGGATCGAATCAAT
AAGGAGTGGAAGATGGAGAAGAAGTCTTCAGATAAGTTCAATCCTGATGTCGGTGGAGAGTCCCAGGAGTAG