Details for Kale Locus Bo5g123070

Position : C5 ( 5`- 37558909 .. 37560975 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g123070

Protein [Map View]
MACNIPMSPQLEQIHGEIRDHFRALANGFQRLDKIKDSTRQTKQLEELTDKMRDCKRLVKDFDRELKDEEASNPPEVNKQ
LNDEKQSMIKELNSYVALRKTYMSTLGNKKIELFDMGAGPSAEPTPEDNVQVASAMSNQELVDAGMKRMDETDQAIQRSK
QVVEQTLEVGTQTAANLKGQTDQMGRVVNHLDTIQFSIKKASQLVKEIGRQVATDKCIMMFLFLIVCGVIAIIVVKIVNP
NNKDIRDIPGLAPPAQSRKLLYLRNPEYMGR*

DNA
ATGGCTTGTAATATCCCGATGAGCCCCCAATTGGAGCAGATCCATGGCGAAATCCGTGACCACTTCCGAGCCCTCGCGAA
TGGTTTCCAGAGGTTGGATAAGATCAAGGATTCAACTCGACAAACCAAGCAACTCGAGGAACTCACTGACAAGATGCGAG
ACTGCAAAAGGTTGGTCAAGGATTTTGACCGTGAACTCAAGGATGAGGAAGCTAGTAATCCTCCTGAAGTAAATAAGCAA
TTGAATGATGAGAAACAGTCTATGATTAAGGAACTCAATTCTTATGTTGCTCTAAGAAAAACGTATATGAGTACCCTTGG
CAACAAGAAGATTGAACTTTTTGATATGGGAGCTGGACCCAGCGCCGAACCTACACCTGAGGACAATGTTCAAGTCGCTT
CAGCTATGTCAAACCAGGAGCTTGTTGATGCTGGAATGAAAAGAATGGATGAGACTGATCAGGCCATTCAGCGCTCAAAA
CAGGTTGTAGAACAAACACTAGAAGTTGGAACTCAAACTGCAGCTAATTTAAAGGGACAGACGGATCAAATGGGACGCGT
TGTGAACCACTTAGACACGATTCAGTTCTCTATCAAGAAAGCATCACAGCTTGTGAAAGAGATAGGGAGACAGGTGGCTA
CGGATAAATGCATAATGATGTTCCTGTTTCTCATTGTATGCGGTGTGATAGCCATTATCGTAGTGAAGATCGTCAACCCG
AATAACAAGGACATCAGGGACATCCCAGGATTAGCTCCTCCAGCGCAATCGAGGAAGCTACTATACTTGAGGAATCCGGA
GTACATGGGAAGATAG