Details for Kale Locus Bo5g123060

Position : C5 ( 5`- 37557022 .. 37557585 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g123060

Protein [Map View]
MNPEPSQLQCAACEEPEPPFILTVIKDNVFRRLCADCLLKEHRGLFCPVCLDVYVAPPPPDAVNICLLCSSTTHLNCSSS
SSDDHFFTCPPCLDPNNFSFFPKSLDNDGSGTVLDLQKAKALVAAAEIAVASAKNAAAQLEEEAVNKSIESKDAKEKAKE
ALEYLEDVKDKASGKKINPRKRKNSDR*

DNA
ATGAATCCAGAACCGAGTCAACTCCAATGCGCAGCTTGCGAGGAGCCTGAGCCGCCGTTCATCCTCACCGTCATCAAAGA
CAACGTTTTCCGGAGACTCTGCGCTGATTGCTTGCTCAAGGAGCATCGTGGCCTCTTCTGCCCTGTTTGTCTCGACGTCT
ACGTCGCCCCCCCTCCTCCAGACGCTGTTAACATCTGCCTCCTTTGCTCTTCCACCACTCACCTCAACTGCTCATCCTCC
TCCTCCGACGATCATTTCTTCACTTGCCCGCCATGCTTGGACCCTAATAACTTCTCCTTCTTCCCCAAGTCTCTTGACAA
CGACGGCTCAGGAACGGTTCTCGACTTACAAAAGGCCAAGGCTCTCGTCGCAGCGGCGGAGATAGCGGTAGCTTCTGCCA
AGAACGCGGCGGCTCAGTTAGAGGAAGAAGCTGTTAACAAGAGCATCGAATCTAAAGACGCCAAGGAGAAAGCTAAAGAA
GCATTGGAGTATCTTGAGGACGTTAAAGATAAAGCTTCCGGGAAGAAGATTAACCCTAGGAAGAGGAAGAACAGTGACCG
CTGA