Details for Kale Locus Bo5g122910

Position : C5 ( 5`- 37466006 .. 37469450 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g122910

Protein [Map View]
MVREQAEEKEVRKGMRLGKYELGRTLGEGNFGKVKFAKDTVSGQPFAVKIIDKSRIADLNFSLQIKREIRTLKMLKHPNI
VRLHEVLASKTKINMVMELVTGGELFDKIVSNGKLTETEGRKMFQQLIDGISYCHIKGVFHRDLKLENVLLDAKGHIKIT
DFGLSALPQHFREDGLLHTTCGSPNYVAPEVLANRGYEGAASDIWSCGVVLYVILTGCLPFDDRNLVVLYQKICKGDPPI
PRWLSPGARTMIKKMLDPNPVTRITVAGIKASEWFKHEYIPSVPDDDDDEEDIDTDDDAFSVQEVGSEDGKGSDSPTIIN
AFQLIGMSSFLDLSGFFEQENVSERRIRFTSNSSAKDLLEKIENSVTEMGFSVQKKNAKLKVKQEEHNQKGQVGLSVTAE
VFEIKPSLNVVELRKSYGDSSLYRQLYERLLKEVGTSSPEQELVT*

DNA
ATGGTGAGAGAGCAAGCGGAAGAGAAGGAGGTGAGGAAGGGAATGCGACTGGGGAAATACGAGCTTGGAAGGACGCTTGG
CGAGGGTAATTTCGGAAAAGTAAAATTCGCTAAAGACACCGTGTCTGGTCAACCGTTCGCCGTTAAAATCATTGACAAGT
CACGTATCGCCGATCTCAACTTCTCCTTGCAGATAAAAAGGGAGATCAGAACGCTGAAAATGCTGAAACATCCCAACATT
GTCAGATTACATGAGGTCTTGGCTAGCAAAACAAAGATCAATATGGTGATGGAGTTAGTCACTGGAGGAGAATTGTTCGA
CAAAATTGTTTCGAACGGAAAGCTAACAGAAACTGAGGGAAGAAAAATGTTTCAGCAGCTCATCGATGGAATCAGTTACT
GTCACATCAAAGGTGTTTTCCACAGGGATCTCAAGCTAGAGAATGTTCTTCTTGATGCAAAGGGACATATAAAGATCACT
GACTTTGGCCTCAGTGCTCTGCCTCAGCATTTTAGGGAAGACGGATTGCTACATACAACCTGTGGAAGTCCTAACTACGT
TGCGCCTGAGGTTTTAGCTAACAGAGGCTACGAGGGTGCAGCATCTGATATATGGTCATGTGGTGTAGTCCTGTATGTGA
TTCTAACCGGATGTCTCCCTTTTGATGATAGAAACCTTGTAGTTCTTTACCAGAAGATATGCAAAGGAGACCCACCGATA
CCACGTTGGTTATCACCTGGTGCAAGAACCATGATCAAGAAAATGCTAGATCCAAATCCAGTCACCAGGATCACGGTCGC
AGGTATTAAAGCCAGCGAATGGTTCAAGCACGAGTACATTCCTTCAGTTCCAGATGATGATGATGACGAAGAAGACATTG
ACACAGACGACGATGCTTTCTCAGTCCAAGAAGTCGGATCGGAAGATGGAAAGGGCAGTGATTCACCGACTATCATCAAC
GCGTTTCAGTTGATCGGAATGTCTTCCTTCCTTGACCTGTCTGGTTTCTTTGAACAAGAGAATGTATCAGAGAGGAGAAT
AAGATTTACTTCAAATAGCTCAGCAAAAGATTTACTGGAGAAAATCGAAAACTCAGTTACAGAAATGGGATTCAGTGTAC
AAAAGAAAAATGCAAAGTTGAAAGTAAAGCAAGAAGAACATAACCAGAAGGGTCAAGTTGGTTTATCAGTAACAGCTGAG
GTTTTCGAGATAAAGCCGTCACTGAACGTGGTTGAGTTAAGAAAATCTTATGGCGATTCATCTTTGTATAGACAGTTGTA
CGAGAGACTATTAAAAGAAGTAGGCACTTCCTCGCCGGAACAAGAGCTAGTAACATAG