Details for Kale Locus Bo5g122890

Position : C5 ( 5`- 37446703 .. 37447593 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g122890

Protein [Map View]
MGLGKRVYGLCIVSLVLMAVVTMATIEEEAAKDESWTDWAKEKIGLKHEEHNVPTTHTTTTVQDNVYGATDKAKDAKEAA
RRKAEEAVGTTKEKAEGAYETAKSKAGETIGSVKDKASQSYDSAGQVKDDLTHKSKQVKDSLSGDNSDESWTDWAKEKVG
IKHGDDESYPNVGDTVSEKAKEAKDAAKRKAGDAKVRLEETVEAAKEKASDLTSAAKEKAERLKEEAERERKSAKDKSKE
SYETAKSKADETLESAKDKASQSYDSAAKKTEQAKDSVSQKSKKVKDTLNDDDAEL*

DNA
ATGGGTTTAGGGAAGAGAGTGTACGGTTTGTGTATTGTATCTTTGGTACTTATGGCTGTTGTAACGATGGCCACCATCGA
AGAAGAAGCGGCTAAGGATGAATCATGGACTGATTGGGCCAAGGAGAAGATCGGTCTGAAACATGAAGAGCACAACGTCC
CGACCACTCACACCACCACAACAGTCCAAGACAACGTTTATGGAGCCACTGATAAGGCCAAGGACGCTAAGGAAGCAGCC
AGACGCAAAGCAGAGGAAGCCGTTGGAACCACTAAGGAGAAAGCAGAGGGGGCTTACGAGACGGCAAAATCAAAAGCCGG
AGAGACCATTGGTTCCGTGAAAGACAAGGCATCGCAGAGCTACGATTCAGCCGGTCAAGTTAAAGATGACTTGACTCACA
AGTCAAAGCAAGTTAAAGACAGTCTGTCCGGGGATAACAGCGATGAGTCATGGACCGATTGGGCTAAAGAGAAAGTCGGA
ATCAAGCATGGAGATGACGAAAGCTACCCTAACGTGGGGGACACGGTGTCGGAGAAGGCCAAAGAAGCTAAAGACGCAGC
CAAACGCAAAGCGGGAGACGCTAAGGTGAGGTTGGAAGAAACGGTTGAGGCGGCTAAGGAGAAAGCGAGCGATCTGACGA
GTGCGGCTAAGGAGAAGGCGGAGAGGTTGAAGGAGGAAGCGGAGAGAGAGAGAAAGAGTGCGAAGGACAAGAGTAAAGAA
AGCTACGAGACTGCTAAATCTAAAGCCGATGAGACTTTGGAGTCTGCTAAAGATAAAGCGTCTCAAAGCTACGACTCAGC
TGCAAAGAAAACAGAGCAAGCAAAAGATAGCGTGTCGCAGAAGTCAAAGAAAGTTAAGGATACCTTGAACGATGATGATG
CTGAGCTCTAA