Details for Kale Locus Bo5g122860

Position : C5 ( 5`- 37405071 .. 37405319 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g122860

Protein [Map View]
MASWKKTIASPFKKAATFFNQPQQSPQKGGRGGRMDAKAREEHERRMVQELQGEVMACGYDDVLVMWSILDKSNSSNNLT
SS*

DNA
ATGGCATCATGGAAGAAAACAATAGCATCACCATTCAAGAAGGCAGCAACATTCTTCAACCAACCACAGCAATCACCACA
AAAGGGTGGCCGCGGTGGAAGAATGGATGCAAAAGCGAGGGAAGAGCACGAGAGGAGGATGGTACAAGAGCTTCAAGGAG
AAGTCATGGCTTGTGGTTACGATGATGTTCTCGTCATGTGGTCTATTCTCGACAAATCTAACTCCTCCAATAACCTCACT
TCTTCTTAA