Details for Kale Locus Bo5g122850

Position : C5 ( 5`- 37401069 .. 37403140 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g122850

Protein [Map View]
MKVSGSTNWKGPVKFRMPTAENLVPIRLDIQFEGQRYKDAFTWNPSDADNEIAIFARRTVKDLKLPPAFFTQISQSIQSQ
LADFRAYEGQDMYTGEKIIPIKLDLRVNHTLIKDQFLWDLNNFESDPEEFARTLCKDLGVEDPEVGPAVAFAIREQLYEI
AVQSVSSARESRLSKKSRRGSDYGSASKASGLSMDLVKLFSFKSSVVRKRKDLDVYEPMVDLLTNEEVDALEAREERHAR
*

DNA
ATGAAGGTTTCAGGGTCTACTAATTGGAAAGGTCCCGTCAAGTTCAGGATGCCTACTGCTGAGAACTTGGTACCTATTCG
TTTGGACATTCAATTCGAAGGTCAGCGTTACAAAGATGCCTTCACTTGGAACCCTTCAGACGCGGATAATGAGATCGCTA
TCTTCGCTAGAAGGACTGTTAAAGACTTGAAACTTCCCCCTGCGTTCTTCACTCAGATTTCTCAATCTATTCAGTCTCAG
CTCGCAGACTTTCGAGCATATGAAGGACAAGATATGTACACTGGTGAAAAAATCATACCAATCAAGCTTGATCTCCGAGT
TAATCACACCCTCATCAAGGATCAGTTCTTGTGGGACCTGAACAATTTCGAGAGTGATCCTGAGGAATTTGCAAGGACCT
TGTGCAAGGATTTAGGTGTTGAAGATCCTGAAGTTGGACCTGCTGTTGCATTTGCAATCAGAGAACAACTTTACGAGATT
GCAGTTCAAAGTGTGAGTTCAGCTAGGGAGAGTAGATTAAGCAAGAAAAGCCGCAGAGGATCTGATTATGGTTCAGCGAG
CAAGGCGAGTGGCTTGTCAATGGACCTAGTGAAGTTATTCAGCTTTAAGTCCAGTGTAGTTCGGAAAAGGAAAGACTTGG
ATGTTTATGAACCAATGGTGGATCTGCTAACAAATGAGGAAGTTGATGCTCTTGAAGCCAGAGAAGAGAGGCATGCACGG
TGA