Details for Kale Locus Bo5g122830

Position : C5 ( 5`- 37380373 .. 37381002 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g122830

Protein [Map View]
MSLQRPNGNSSSSSSPKKHKTEESDEEELLMALDMEAAGSTGVLSSNADDGVNKPEIDQTQNVTSTAKRGRRRDPVDKEY
RRHKRLLRNRVSAQEARERKKVYVSDMESRANELQNNNDELGEKISTLMNENTMLRKMLINTRPKADDSH*

DNA
ATGTCTCTTCAACGACCCAATGGGAACTCGAGTTCCTCTTCTTCCCCCAAGAAGCACAAAACTGAGGAGAGTGACGAGGA
GGAGTTGTTGATGGCTCTTGACATGGAAGCAGCTGGATCAACAGGTGTTCTAAGCAGCAACGCCGACGACGGAGTCAACA
AACCGGAGATTGACCAGACCCAAAACGTAACTTCAACCGCCAAGCGGGGCCGTAGACGAGACCCAGTCGATAAAGAATAC
AGAAGACACAAGCGATTGTTGAGAAATAGGGTATCGGCACAAGAAGCGAGGGAGAGGAAGAAAGTGTATGTGAGTGATAT
GGAATCAAGAGCTAACGAGTTGCAGAACAACAATGATGAGCTTGGGGAGAAGATCTCTACTTTGATGAACGAGAACACAA
TGCTTCGCAAAATGCTTATCAACACTAGGCCTAAAGCTGATGACAGTCACTAG