Details for Kale Locus Bo5g122820

Position : C5 ( 5`- 37377980 .. 37379062 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g122820

Protein [Map View]
MAYSVEGRRRANGGMLPLLALSTVAEYYRLPWKPPVTASLLAANTLIYLRPAFIDPVIPHINEVWFNPNLILKHKDLKRF
FLSPFYHVDEPHLVYNMMSLLWQGIKLETSMGSSEFASMVFTLLGMSQGVTLLLAKSLHVFFDYERAFYSEYSVGFSGVI
FALKVVLNSQDEDYTSVYGILVPTKYAAWAELVLVQMFMPSASFLGHLGGILAGILYLKIKRSSHSGSDPVTMVVRGVTR
ALTWPLRFMSGLVRFRRRRISGRGRVGRGQNGIWRCHSCTYDNSGWQSVCEMCGLGRGRGNGWSVNQGQTPSSSSSSDIP
LDELRRLRVERFS*

DNA
ATGGCGTATTCTGTTGAAGGAAGAAGAAGAGCAAACGGAGGGATGCTTCCTCTTCTGGCGCTCAGCACCGTCGCTGAGTA
CTACAGACTGCCGTGGAAACCACCGGTGACGGCAAGTCTATTAGCCGCCAACACTCTCATCTATCTTAGACCGGCGTTCA
TCGATCCGGTTATCCCTCACATCAACGAGGTCTGGTTCAATCCAAATCTCATCCTCAAGCACAAGGACTTGAAACGCTTC
TTTCTATCACCGTTCTACCATGTAGACGAGCCTCACCTAGTCTACAACATGATGTCTCTTCTCTGGCAAGGTATCAAGCT
CGAGACATCCATGGGAAGCAGCGAGTTCGCTTCCATGGTGTTTACGCTTCTCGGTATGTCCCAAGGAGTCACGTTGCTGT
TAGCCAAGTCTCTCCACGTGTTCTTCGACTACGAAAGAGCCTTTTACAGTGAGTACTCCGTGGGGTTCTCTGGCGTCATC
TTTGCTTTGAAAGTTGTTCTCAATTCTCAGGATGAGGATTACACCAGCGTGTATGGTATCCTAGTCCCGACTAAGTACGC
TGCTTGGGCAGAGCTGGTTCTTGTGCAGATGTTTATGCCTAGCGCTTCGTTTCTTGGGCATTTGGGTGGGATTCTTGCTG
GTATTCTCTACTTGAAGATCAAACGTTCTTCTCACTCGGGATCAGACCCTGTGACTATGGTGGTTAGAGGTGTTACTCGA
GCGCTGACTTGGCCGTTGAGGTTTATGAGCGGTTTGGTTAGGTTTCGGAGGAGGAGGATTTCAGGGAGAGGACGAGTGGG
GAGAGGCCAGAATGGTATCTGGAGATGCCATTCGTGTACTTATGACAATTCTGGTTGGCAAAGTGTTTGTGAGATGTGTG
GCTTGGGACGGGGTAGAGGTAACGGATGGTCAGTGAACCAGGGACAGACACCTTCTTCTTCTTCTTCTAGTGATATTCCT
TTAGATGAGCTGCGTCGTCTAAGAGTAGAGAGGTTTAGTTAA