Details for Kale Locus Bo5g122780

Position : C5 ( 5`- 37348540 .. 37349727 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g122780

Protein [Map View]
MNYTFFLLLLTLVHSTFSSLAPPDQAALESIRDSLTDMPGSAFFSTWDFTTPDPCSTFSGLTCTSLGRVSALSLGPNLSG
SLSPSISNLTRLTQLVLYPGLVTGPLPPRFDTLSLLRVISLTRNRLTGPIPNSLSALSYLHTLDLSYNQLSGSLPPFLTT
LPRLKVLVLASNRFSDNVKPVSSPLLHLDLKMNQISGQLPPLFPTTLRYLSLAGNSISGTIIPLEPLTDLTYIDLSMNRF
TGAIPQSLFGSTTTSMFLQRNNFTSINATSSLMLPQGSVVDLSHNYISGELPPSLAGAESLFLNNNRFTGEIPEEYIKSL
INGTTKTLFLQHNYLTRFPWNSGSQLPDSVSLCLSYNCMDTDPVVGLSTCPIEVAPLLSRPAIQCSRFYNHSSTG*

DNA
ATGAACTACACTTTCTTCTTACTTCTCCTCACTCTTGTCCACTCCACTTTCTCTTCCCTAGCTCCACCAGACCAAGCCGC
TCTTGAATCCATAAGAGACTCCTTAACCGACATGCCCGGTTCAGCCTTCTTCTCAACTTGGGACTTCACAACCCCTGACC
CTTGCTCCACCTTCTCAGGCCTAACTTGCACTTCCCTCGGCCGTGTCTCCGCCTTATCACTCGGCCCTAACCTCTCCGGT
TCACTATCCCCATCCATCTCCAACCTAACCCGTTTGACCCAACTCGTTCTCTACCCCGGTTTAGTCACCGGACCTCTCCC
TCCCCGGTTCGATACCCTCTCTCTCCTTCGAGTCATTTCTTTAACCAGAAACCGCTTAACCGGTCCTATACCAAACTCTC
TCTCAGCTCTCTCGTACCTCCACACTCTTGACCTTAGCTATAACCAACTCTCAGGCTCTCTCCCTCCGTTTCTCACCACA
CTTCCTCGTCTCAAAGTCCTTGTCTTAGCCTCGAACCGTTTCTCCGACAACGTTAAACCTGTCTCTAGCCCTTTGCTTCA
CTTAGACCTAAAGATGAACCAAATCTCCGGCCAACTCCCGCCTCTTTTCCCCACCACTCTCCGGTACTTATCCCTCGCCG
GAAACTCAATCTCCGGCACAATCATCCCCTTGGAGCCACTCACAGACCTAACGTACATCGATCTCAGCATGAACCGGTTC
ACCGGAGCGATCCCGCAATCACTCTTTGGTTCCACAACCACATCAATGTTCTTACAACGAAACAACTTCACATCCATCAA
CGCCACGTCGTCGTTAATGTTACCTCAGGGCTCCGTCGTCGACCTGAGCCATAACTACATCTCCGGCGAGTTGCCTCCTT
CCCTCGCCGGAGCAGAGTCTCTGTTCTTGAACAACAACCGTTTCACAGGAGAGATTCCAGAGGAGTACATCAAGAGCTTG
ATCAACGGTACGACGAAAACGCTCTTCTTGCAACATAACTACTTAACGAGATTCCCGTGGAACTCTGGATCTCAACTACC
GGACTCTGTTTCGCTCTGTTTGTCGTATAACTGTATGGATACGGATCCAGTTGTTGGTTTGTCCACGTGTCCGATAGAAG
TTGCACCTCTGCTCTCAAGGCCTGCTATACAATGTTCTCGCTTTTACAATCACAGCTCCACTGGTTAA