Details for Kale Locus Bo5g122770

Position : C5 ( 5`- 37343891 .. 37345959 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g122770

Protein [Map View]
IFPSCLLQIRSSSEIIFLLYYKLLFHFQLLPSPLSLYSHIRMNGKASVSKELNAKHSKILEALLKHPDNRECADCRSKAP
RWASVNLGIFICMQCSGIHRSLGVHISQVRSITLDTWLPDQVSFMQSTGNAKANQYWESELPPHFERSSSDAFIRAKYNE
KKWVSRGGIQPAPVVNQLSCKVSHSVERGHKPETPTKTRTRSLDEDILLKHVLEVTPPETRIRAGSVDMKMKENVYVLPL
PVGINVNKPNQKNEIFSGDLYQNRRTTIAPPSSWATFDCAGAMEGVDCVRSTSMI*

DNA
ATCTTTCCCTCTTGTCTCCTTCAAATCCGTTCTTCCTCAGAGATCATTTTCCTTCTCTATTACAAACTTTTGTTTCATTT
TCAATTGCTTCCCTCTCCCCTCTCTCTCTATTCTCACATCAGAATGAACGGGAAGGCCTCTGTTTCCAAGGAGCTCAACG
CCAAGCATTCCAAGATATTGGAAGCACTTTTAAAGCATCCAGACAATCGAGAATGTGCTGATTGTAGATCAAAGGCACCA
AGATGGGCAAGTGTGAACCTTGGGATATTCATATGTATGCAATGTTCTGGAATCCATCGCAGCCTTGGTGTCCACATCTC
TCAGGTGAGGTCTATAACTCTGGATACATGGCTTCCTGATCAGGTTTCTTTCATGCAATCTACCGGTAATGCTAAGGCAA
ATCAGTATTGGGAATCAGAACTGCCTCCTCATTTTGAGAGAAGCTCAAGCGACGCGTTTATTAGAGCCAAATACAATGAG
AAGAAATGGGTTTCACGGGGAGGGATTCAACCGGCTCCTGTAGTGAACCAGCTAAGCTGCAAAGTTAGTCACTCGGTAGA
GAGAGGACATAAGCCGGAGACTCCCACGAAAACAAGAACTCGTTCCCTTGATGAAGATATCCTCCTTAAGCATGTTCTTG
AAGTAACACCTCCAGAAACAAGAATCCGAGCGGGTTCGGTGGATATGAAGATGAAGGAGAATGTATATGTTCTACCTCTA
CCAGTGGGGATAAATGTTAATAAACCAAATCAAAAGAATGAGATATTCTCCGGAGATTTATATCAGAATAGAAGAACCAC
CATTGCACCACCCTCGAGCTGGGCTACTTTCGACTGTGCAGGAGCTATGGAGGGAGTGGATTGTGTTCGATCCACAAGCA
TGATTTAG