Details for Kale Locus Bo5g122760

Position : C5 ( 5`- 37340000 .. 37341955 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g122760

Protein [Map View]
MSLWIYAHLHFPFIKMTNKNKYLSGLKKMKSKGTMDVVTHLPPQLPTLSDLEARMQLLRVSALEESQGDDDTFAQRAEWF
YHRRPLLLSLCLDLYNGYLTLLGRSHQTRPNQQLIHAPSHPNHLLQDEEDCVSEVDSGSEISSESTLSFQQMEDPATVSE
KVDELVSQLVTANLDKEILQDELLNKEEKFCEAAKTIELLKKFVMLLEMEKEVAVEENANLGYKVTSLLEENRELATEAL
FMKNEAVGLARCVLKMRDDHFHKVCILQNRIYSLQASQNSEPVYDKVSTGCFGLDKYKTKKKKENKTEDKTGFKWLKKLN
NISLFTKLSFRKKIEITMLHQGSWFSSLMILSAIFSLTSLMLKSEGANHTVGDSSGWELLTNYTNWTEGREFHVGDVLVF
NYNKDQHNVMQVNSTAYADCGRDNYISLFTNGNDSIIISEVGEHWFICAMYDHCENGQKLSINATL*

DNA
ATGTCTCTCTGGATCTACGCACATTTACATTTTCCTTTTATAAAAATGACTAACAAGAACAAGTATCTTTCAGGATTGAA
GAAGATGAAGAGCAAAGGAACCATGGACGTCGTCACTCATCTTCCTCCACAGTTGCCAACTCTCTCCGACCTTGAAGCTC
GGATGCAACTCCTGCGTGTGTCTGCTTTGGAAGAAAGCCAGGGAGATGATGATACATTTGCTCAACGTGCTGAATGGTTT
TACCACAGAAGACCTCTCCTTCTCTCCCTTTGTCTTGACCTTTACAACGGCTACCTCACTCTCCTGGGCCGTTCTCATCA
AACCAGACCGAACCAGCAGCTTATACACGCACCTTCTCATCCAAATCACCTCCTCCAAGATGAAGAAGACTGCGTTTCAG
AGGTTGATTCCGGTAGCGAGATCAGTTCGGAGAGCACCTTATCCTTTCAACAGATGGAAGATCCTGCTACGGTCTCAGAG
AAAGTCGATGAGCTTGTGTCCCAACTTGTGACTGCAAACTTGGACAAAGAGATTCTGCAAGACGAGTTACTCAATAAGGA
GGAGAAGTTTTGTGAAGCCGCCAAGACCATAGAGCTGTTGAAGAAGTTCGTCATGCTGCTGGAGATGGAGAAGGAAGTGG
CTGTGGAGGAAAACGCTAATCTTGGATACAAAGTCACTTCTCTCTTGGAAGAGAACAGAGAGCTAGCCACTGAGGCGTTG
TTCATGAAGAACGAAGCTGTTGGGCTCGCTAGGTGTGTGCTTAAGATGAGAGATGACCACTTCCACAAGGTCTGCATCCT
CCAGAACCGCATCTATTCGCTTCAGGCATCGCAGAACTCCGAGCCTGTCTATGATAAGGTCTCAACCGGATGCTTTGGCC
TGGATAAGTACAAGACCAAGAAGAAGAAGGAGAACAAAACCGAAGACAAGACTGGATTCAAGTGGTTGAAGAAGCTGAAC
AACATTAGCCTCTTCACAAAACTGAGCTTCAGAAAAAAAATAGAGATAACAATGCTTCATCAGGGAAGCTGGTTCTCCAG
CTTGATGATACTCTCTGCCATTTTCTCTTTAACTTCGCTCATGCTAAAATCTGAAGGAGCAAACCATACAGTTGGCGACA
GCTCTGGCTGGGAACTCTTGACAAACTATACCAACTGGACAGAGGGAAGAGAGTTTCATGTCGGCGATGTCTTAGTTTTC
AACTACAACAAGGACCAGCATAACGTTATGCAAGTTAACTCTACCGCATACGCAGATTGTGGAAGAGATAATTACATCTC
CCTCTTCACCAACGGCAACGACTCAATAATTATATCAGAGGTTGGAGAGCACTGGTTCATCTGTGCAATGTACGATCACT
GTGAGAATGGCCAGAAGCTAAGTATTAATGCAACTCTTTGA