Details for Kale Locus Bo5g122720

Position : C5 ( 5`- 37315175 .. 37318430 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g122720

Protein [Map View]
MEKDDVPMLPVSDSSSLSRTRPFTSRSRSVSLANTSSIIDGFDSSTVVLGYTGPLRTRRRPPLVQMSGPLSSTRSSEPLF
LPPPPTSTRDVSSSQPERYPSFTALEHKNSEEEFVLKHAHLLRSGQLGMCNDPYCTTCPSYYNRKAAQIPTSRVSAIFDS
TFHDAKGWARRFATSINRHLPGIMNPHSKFVQSWTKFFAFSCLLAIFIDPLFFFLILVKQNNNCIEIDWPMAHTFVAVRS
VTDVLFSVNILLQFRLAYVAPESTVVGAGQLVDHPRKIASHYFRGKFLLDLFIVMPLPQILILWIIPAHLAISGANYAKN
LLRAAVLFQYIPKLYRLLPLLAGQTPTGFIFESAWANFFINLLTFMLAGHVVGSCWYLFGLQRVNQCLRDACGNTDRPCR
ELIDCHGETSALSAAWKDNAGASACFQEDGFPYGIYLKAVNLTNHNSLFTRYSYSLFWGFQQISTLAGNLIPSYFLGEVF
FTMGIIGLGLLLFALLIGNMQNFLQSLGRRNLEMTLRRRDVEQWMRHRRLPGDIRKRVREAERFNWAATRGVNEELLFKN
MPDDLQREIRRHLFIFLKKVRIFSVMDESILDAIRERLKQRTYIRSSMVLHRGGLVEKMVFIVRGEIESVGEDGYVLPLS
EGDVCGEELLTWCLERSSVNPDGTRIRMPSKGLLSNRNVRCVTNVEAFSLSVADLEDVTSLFSRFLRSNRVQGAIRYESP
YWRLRAAMQIQVAWRYRRRRLQRLYTDQSSYSL*

DNA
ATGGAGAAGGATGATGTTCCCATGCTTCCAGTTTCAGACTCATCATCGTTATCTCGTACTAGGCCTTTCACTTCCAGGTC
ACGTAGCGTTTCTCTCGCAAACACTTCTTCGATCATTGATGGGTTCGACAGCTCGACTGTTGTTTTAGGCTACACAGGTC
CTCTTCGAACTCGTAGAAGGCCTCCTTTAGTTCAGATGAGTGGCCCTCTCTCATCTACTCGCAGTTCTGAGCCTCTCTTT
CTTCCTCCTCCTCCTACTTCCACTCGCGATGTCTCCTCCTCTCAGCCTGAGAGGTACCCTTCTTTTACTGCTCTCGAACA
CAAAAACTCAGAGGAAGAGTTCGTATTAAAACACGCACATCTCTTGAGATCTGGACAGTTGGGTATGTGTAATGATCCTT
ACTGTACCACTTGTCCTTCTTACTACAACCGGAAAGCTGCCCAAATCCCTACTTCTAGAGTTTCTGCCATTTTTGATTCC
ACTTTCCATGATGCTAAGGGTTGGGCTAGGAGGTTTGCTACATCTATTAATAGACACTTACCAGGAATCATGAATCCTCA
CTCCAAGTTCGTTCAGAGCTGGACTAAGTTCTTTGCCTTTTCTTGCTTGTTAGCTATTTTCATAGATCCCCTCTTCTTCT
TCCTCATATTAGTCAAGCAGAACAACAATTGCATTGAGATTGATTGGCCGATGGCTCACACATTTGTAGCTGTTAGAAGT
GTAACAGATGTTTTGTTCTCTGTAAACATTCTGCTTCAGTTCCGATTAGCCTATGTAGCTCCTGAGTCTACGGTTGTTGG
TGCTGGCCAGTTGGTAGACCATCCAAGAAAAATTGCTAGTCATTACTTCCGAGGAAAGTTTTTACTAGATTTGTTCATAG
TGATGCCACTTCCACAGATATTGATATTATGGATAATACCAGCACACTTAGCCATATCTGGGGCAAACTATGCAAAGAAC
CTTTTACGTGCTGCAGTTCTTTTCCAATACATTCCCAAGTTGTATAGGCTACTACCACTTCTTGCTGGACAAACACCGAC
TGGCTTCATCTTTGAGTCGGCTTGGGCTAATTTTTTTATTAATCTTCTCACCTTCATGCTTGCTGGTCATGTCGTTGGCT
CTTGTTGGTATCTTTTTGGTCTGCAGAGAGTTAATCAATGCCTTCGAGATGCTTGCGGTAATACCGATCGTCCATGCAGA
GAGCTTATAGATTGTCATGGTGAAACTAGCGCTTTATCAGCTGCGTGGAAAGATAACGCGGGTGCCAGTGCTTGTTTTCA
AGAGGATGGTTTTCCTTATGGAATCTATTTGAAGGCAGTTAATCTCACCAATCATAATAGCCTCTTCACAAGATACAGTT
ACTCTCTTTTTTGGGGTTTCCAGCAAATCAGCACGCTTGCTGGAAACCTAATTCCAAGTTACTTTCTTGGGGAGGTCTTC
TTCACCATGGGCATTATCGGATTGGGGCTTTTGCTTTTCGCTCTTCTTATTGGTAATATGCAGAACTTCCTTCAATCTCT
CGGTCGAAGGAATTTGGAAATGACTTTGAGACGGCGTGATGTGGAGCAATGGATGAGGCATAGACGGTTGCCAGGAGATA
TTAGAAAGAGGGTGCGAGAGGCTGAGCGGTTCAACTGGGCTGCTACCAGAGGAGTTAATGAAGAATTGTTGTTTAAGAAT
ATGCCTGATGACCTTCAAAGAGAGATAAGAAGACACCTCTTCATATTTCTCAAGAAGGTGAGGATATTTTCGGTGATGGA
TGAATCAATCTTAGATGCTATACGTGAGAGGCTGAAACAAAGGACTTACATAAGGAGTAGCATGGTCTTGCACCGCGGAG
GTCTAGTTGAGAAAATGGTATTCATAGTGAGAGGTGAGATAGAGAGCGTTGGAGAAGATGGTTATGTTCTACCATTGTCA
GAAGGAGACGTTTGTGGTGAAGAACTTCTCACTTGGTGCCTCGAACGCTCTTCTGTGAACCCCGATGGGACAAGGATACG
GATGCCCTCAAAGGGACTGCTTAGCAACAGAAACGTTAGGTGTGTGACAAACGTGGAGGCGTTTTCGCTGAGTGTAGCAG
ATCTTGAAGATGTAACGAGCTTGTTCTCTAGATTCCTAAGGAGCAATCGTGTGCAAGGAGCCATAAGGTATGAGTCTCCT
TATTGGAGGCTACGAGCAGCTATGCAGATTCAAGTGGCTTGGAGATACCGAAGGAGACGGCTTCAGAGATTGTACACTGA
TCAGTCTAGTTACAGCCTCTAG