Details for Kale Locus Bo5g122650

Position : C5 ( 5`- 37261955 .. 37263701 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g122650

Protein [Map View]
MPRIITWILVLIQIILLMAPFTGRLHLHIMNVPRYKLDNSQRGSESGSTKLYLRNRRGSMLEAEIDVNSLDGKAKSDHRY
WYAKNAAMEPNKNFRRIRLSASSREAVDSLFDRFIPLEEGEAVQESEEEDVSVMGMSWEDEVLNKTREFNRQTRERPHDE
RTWLAFADFQDKVSSMQSQKGARLQTLEKKISILEKAFELNPDSEELLLVLLKAYRSRDSADMDATSEPLDSTLIQQELV
LVDMLVSLCRFEWQAGYRELATALFQAEMEYSIFSPSLLLSEQNKLRLFEHFWSSNGARVGEEGVFGWSLWLEKEEEQRQ
KMLKEESSDDNDVGGWTGWTEQLSDRKKDSSIASANPGEGDVNREGLEEEMEEENGMPEDDTEAMLKLLGIDVDAVASDE
VKDTSTWVKWFEEEVSRDQNQWMPTRKAGIYLYVYHY*

DNA
ATGCCAAGGATTATTACTTGGATACTCGTCCTGATCCAGATAATCTTGCTTATGGCTCCATTTACAGGTCGTTTACATCT
CCACATAATGAATGTTCCTCGTTATAAACTTGATAATTCTCAGAGAGGTTCTGAGTCAGGTTCTACGAAGCTTTATCTAA
GGAATAGGCGTGGTTCTATGCTTGAAGCAGAGATTGATGTTAATTCTTTGGACGGGAAAGCAAAGTCTGATCACAGATAC
TGGTATGCAAAGAATGCAGCCATGGAACCGAACAAGAATTTCAGGCGTATTCGTTTGTCTGCTTCTTCTAGAGAGGCTGT
TGATTCGTTGTTTGATCGTTTCATTCCTCTGGAGGAAGGTGAAGCTGTTCAAGAAAGCGAAGAGGAAGATGTTTCAGTGA
TGGGAATGTCATGGGAGGATGAGGTGTTGAATAAAACCCGAGAGTTCAACAGACAGACGAGGGAACGTCCCCATGATGAA
AGGACCTGGCTGGCATTTGCTGATTTTCAAGACAAGGTTTCGAGTATGCAGTCTCAGAAAGGTGCTCGCTTGCAGACTTT
GGAGAAGAAGATTAGTATACTTGAGAAGGCTTTTGAATTGAACCCAGATAGCGAAGAACTGTTACTTGTGCTTCTCAAGG
CGTACCGAAGCAGAGACAGCGCAGATATGGATGCAACATCTGAACCATTGGATTCTACTCTCATCCAGCAGGAACTTGTT
CTAGTGGATATGCTAGTTAGCCTCTGCAGGTTTGAATGGCAGGCTGGTTACCGGGAGCTGGCCACAGCGTTATTTCAAGC
TGAAATGGAATATAGCATCTTTTCTCCATCTTTGTTGCTAAGTGAACAGAATAAATTAAGACTGTTTGAACACTTTTGGA
GCAGTAATGGTGCTAGAGTTGGAGAAGAAGGAGTTTTTGGATGGTCTTTGTGGTTGGAGAAAGAGGAGGAACAAAGGCAA
AAAATGTTGAAAGAGGAATCTTCTGATGACAATGACGTAGGCGGTTGGACAGGTTGGACAGAGCAGTTGTCAGATAGGAA
AAAAGACAGTAGTATTGCTTCAGCTAACCCTGGAGAAGGTGATGTTAATCGGGAAGGCCTGGAAGAAGAAATGGAAGAAG
AGAATGGCATGCCCGAAGATGACACTGAAGCTATGTTAAAGCTGTTAGGCATTGATGTTGATGCTGTGGCCAGTGATGAG
GTTAAAGATACTTCAACATGGGTCAAATGGTTTGAAGAAGAGGTTTCTCGAGATCAAAATCAATGGATGCCTACTCGAAA
AGCTGGTATTTATCTCTACGTTTACCATTATTAA