Details for Kale Locus Bo5g122640

Position : C5 ( 5`- 37249669 .. 37253638 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g122640

Protein [Map View]
MEEASCSSIDSILEFLRKNRFMRAEAALISELSNNSSSSNGVKSKVFDKKQGRDKNQVSDELVVKEIQCGSATESHHQQM
NDVSVQTQSPSGANNSSLWEDRFTFSESLVDTELDLPPWNHADSEVYSIDPSIRSFVNPRSSKPSSHDNVPRQVSQYDHG
KASHSLEDDSMAAIQEGFITTSWPRSEERTDHWKDCSVTTVYPLSKGSTSTNNLGVPVVDKRQGKKKVGASDSKVVIKEQ
DDDDVETALCLGKSHSGYDVKNLSGFAFSLAHDGAREDLPRLPHVRIKSEDKSMNYTSEEKHERDVLDEKLINTENGFLI
GSYLDVPIGQEIHSSGGRIAGGGNWLSVSQGLAEDASDLIFGFGNGLGDLAEHSNEYWDSDEYDDDDDVGYIRQPIEDEA
WFLGHEVDYPSEQEKDTEHTQDKSQTKNEDDHSFAEEDSYFSGEQYVLAKGVEPVTTKEPDLVARYDGELMDATELSLMR
AEPVWQGLVTHENDLVLSNKGRGDDNGGRFCSKDIRAEDDRNAAVRSIGVGISDDVDDNGCIAPDYFPGEGSEWDLELLP
HRRVGAASVKPPPGKGANMQLKSFTNGGFSFPSPVPDGHISHDDSTNPVWSNPAVRNESYGPKGLTESNSMVDRNGEKVE
SSRSSSPSAVSHSSYTGREHCKEEDEEETSPAPEEDPGTSFEDEDAIVVQEQVRQIKAQEQEFETFNLKIVHRKNRTGFE
EDKNFHVVLNSVIAGRYHVTEHLGSAAFSKAIQAHDLHTGIDVCVKIIKNNKDFFDQSLDEIKLLKYVNQHDPADKYHLL
RLYDYFYFREHLLIVCELLKANLYEFQKFNRESGGEVYFTMPRLQSITIQCLEALNFLHGLGLIHCDLKPENILIKSYSR
CEIKVIDLGSSCFETDHLCSYVQSRSYRAPEVILGLPYDKKIDIWSLGCILAELCSGNVLFQNDSPATLLARVIGIIGSI
DQQMLAKGPDTCKYFTKTYLLYERNQESNNLEYLIPKKSSLRRRLPMGDQGFIDFVAHLLQVDPKKRPSASEALKHPWLT
HPYEPISP*

DNA
ATGGAGGAAGCTAGCTGCTCCTCTATCGACTCCATTTTGGAGTTTCTGCGGAAGAACCGTTTCATGAGAGCTGAAGCTGC
GTTGATTAGTGAGCTTTCCAACAACAGCTCAAGCTCAAATGGTGTGAAAAGCAAGGTCTTTGATAAGAAGCAAGGCCGAG
ACAAGAACCAAGTTTCTGATGAATTGGTTGTCAAAGAGATACAGTGCGGATCCGCCACTGAGAGTCATCATCAGCAAATG
AATGATGTTTCTGTTCAGACACAAAGTCCCTCTGGTGCTAATAACTCATCATTATGGGAGGACAGGTTCACTTTTTCCGA
AAGTTTAGTAGATACCGAGCTTGATTTACCCCCATGGAACCATGCTGACTCTGAGGTATACAGTATCGATCCAAGTATAA
GAAGCTTTGTGAATCCAAGAAGCTCAAAACCATCTAGTCATGACAACGTTCCTCGCCAGGTATCTCAGTATGACCATGGC
AAAGCATCTCATTCCTTGGAAGATGATAGTATGGCTGCGATACAAGAAGGGTTTATCACCACCTCATGGCCAAGAAGCGA
AGAGCGCACAGACCATTGGAAGGATTGTTCTGTTACAACTGTTTATCCATTGTCCAAAGGGAGCACATCAACGAATAATC
TCGGTGTACCCGTTGTAGACAAAAGGCAAGGGAAGAAAAAGGTTGGCGCGAGTGATTCAAAGGTTGTTATTAAGGAGCAG
GATGATGATGATGTGGAAACAGCTCTGTGCCTTGGAAAGTCACATTCTGGATATGATGTTAAGAATCTTAGCGGCTTTGC
GTTTTCGCTGGCTCATGATGGTGCGAGGGAAGACTTACCAAGGCTGCCGCATGTGAGAATCAAGTCAGAGGATAAATCAA
TGAACTATACTTCAGAAGAGAAACATGAGCGTGACGTTTTGGATGAGAAGCTGATCAATACTGAGAATGGTTTCCTTATA
GGTTCTTATCTAGATGTTCCTATTGGACAAGAGATCCATTCATCAGGTGGCAGAATAGCTGGGGGAGGAAACTGGTTGTC
TGTAAGTCAGGGACTAGCAGAAGATGCATCTGACTTGATTTTTGGCTTTGGCAATGGACTAGGTGATCTCGCTGAACATT
CAAATGAGTATTGGGACTCCGATGAATACGACGACGATGATGATGTTGGTTACATTAGACAACCAATTGAGGATGAGGCC
TGGTTTTTGGGTCATGAAGTTGACTATCCTAGCGAACAGGAAAAAGACACAGAGCATACTCAGGATAAAAGCCAAACCAA
GAATGAGGATGACCATTCATTTGCTGAAGAGGATTCTTATTTCTCCGGTGAACAATATGTGCTAGCAAAAGGCGTTGAGC
CAGTTACAACTAAGGAACCTGACTTAGTTGCTCGATACGACGGGGAATTGATGGATGCAACGGAGCTAAGTTTGATGCGA
GCTGAGCCTGTGTGGCAGGGACTTGTCACACATGAAAATGATCTAGTTTTGTCGAACAAAGGGAGAGGCGACGATAACGG
TGGTAGATTCTGTTCAAAGGATATCCGCGCAGAAGATGATAGAAACGCTGCAGTTAGGTCAATTGGTGTAGGAATCAGTG
ATGATGTTGATGACAATGGGTGTATAGCACCTGATTACTTTCCTGGAGAAGGTAGTGAATGGGACCTGGAGCTCCTTCCT
CACCGCCGAGTTGGAGCTGCTAGTGTTAAGCCTCCACCTGGCAAAGGTGCAAATATGCAGCTAAAAAGTTTTACAAATGG
TGGTTTCTCCTTTCCTTCTCCAGTACCTGACGGACACATCTCTCATGATGATTCTACAAACCCTGTATGGTCAAACCCTG
CTGTGAGAAATGAAAGTTATGGACCAAAGGGGCTGACTGAGTCCAATAGTATGGTTGATAGGAACGGCGAGAAGGTTGAA
AGTTCAAGAAGTTCCTCTCCATCTGCAGTCTCCCACAGTTCTTATACAGGGAGAGAGCACTGCAAGGAAGAAGATGAGGA
AGAAACTAGTCCTGCGCCGGAAGAAGATCCTGGGACCTCGTTTGAGGATGAAGATGCAATCGTTGTCCAAGAGCAAGTAA
GACAGATTAAAGCCCAAGAGCAGGAGTTTGAAACTTTCAATCTGAAGATTGTTCACAGGAAAAACAGGACTGGTTTTGAG
GAGGATAAGAACTTCCATGTGGTTTTGAACTCTGTCATAGCTGGTCGTTATCATGTCACTGAGCATCTTGGATCAGCAGC
TTTTAGCAAAGCAATACAAGCACATGACCTCCACACAGGCATTGATGTATGTGTAAAGATCATAAAGAACAACAAAGACT
TCTTTGACCAGAGCCTTGATGAGATCAAACTGCTCAAGTATGTCAATCAGCATGATCCTGCTGACAAGTACCATCTCCTT
AGATTGTATGACTACTTCTACTTTCGGGAGCACTTGTTAATAGTATGTGAACTTCTCAAGGCAAACTTGTATGAGTTCCA
AAAGTTTAACAGAGAATCAGGTGGAGAAGTTTATTTCACAATGCCAAGATTGCAGTCAATTACTATCCAGTGCTTGGAAG
CATTGAACTTTCTGCACGGTCTCGGCCTTATACACTGCGACTTAAAACCTGAAAACATACTTATCAAAAGCTACAGCAGA
TGCGAAATCAAAGTTATTGATCTAGGAAGTAGCTGTTTCGAGACGGATCATCTCTGCTCTTATGTCCAGTCTAGATCTTA
CCGTGCTCCAGAAGTCATCCTCGGGCTTCCGTATGATAAAAAGATCGATATCTGGTCACTTGGCTGCATTTTGGCAGAAC
TGTGTTCCGGAAACGTTCTGTTTCAAAATGATTCTCCAGCTACTTTGCTTGCAAGGGTCATTGGTATAATCGGATCCATT
GACCAACAAATGCTTGCAAAAGGACCTGATACATGCAAATACTTCACCAAAACTTATTTGTTATACGAGAGGAACCAGGA
GAGTAACAATTTGGAATATTTGATACCTAAAAAGTCATCGCTAAGGCGTAGACTGCCAATGGGTGACCAAGGGTTTATAG
ACTTTGTGGCACACTTGCTCCAAGTTGATCCAAAGAAACGCCCTTCTGCATCTGAGGCTCTTAAGCATCCATGGTTGACT
CATCCCTACGAACCCATATCTCCATGA