Details for Kale Locus Bo5g122620

Position : C5 ( 5`- 37241721 .. 37245639 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g122620

Protein [Map View]
MVYAAKKFINNPNDVVTEFIEGLVETYPGLQYLDGFPEVKVVLRADVSAEKYDKVAVISGGGSGHEPAHAGYVGEGMLTA
AICGDVFASPPVDSILAGIRAVTGPQGCLLIVKNYTGDRLNFGLAAEQAKSEGYKVETVIVGEDCALPPPRGIAGRRGLA
GTVLVHKVAGAAAAAGLSLEKVAAEAKCASEMVGTMGVALSVCTLPGQVTSDRLGQEKMELGLGIHGEPGAAVVDVQPVD
VVVSHVLQQILSPETNYVPITRGNRVVLMVNGLGGTPLMELMIAAGKAVPKLQLEFGLAVDRVYTGLFMTSLDMAGFSIS
IMKADQSILNRLDAPTKAPNWPVGTDGNRPPAKIPVPIPPSRSAKSAESQARPKELSQQGRVLEAAIHAAATVIISLKDS
LNEWDGKVGDGDCGSTMHRGATAILEDMKHYYPLNDAAETVNEIGASISRAMGGTSGIIYNLLCKAAYAELKANTESEVT
PKYWSKALKSSIASVSKYGGATAGYRTMLDALIPASQVLEEKLSAGEDPICAFILSAEAATKGAESTIQMQAQAGRSSYV
SAEMLATVPDPGAMAAAGWYSAAARAVKEQYQGSS*

DNA
ATGGTTTACGCGGCGAAGAAATTCATCAACAACCCCAACGATGTTGTGACTGAGTTCATCGAGGGACTTGTGGAAACTTA
TCCTGGACTCCAGTATTTGGATGGCTTTCCTGAGGTTAAGGTGGTGCTACGAGCTGATGTCTCTGCTGAGAAGTATGACA
AGGTTGCCGTTATATCAGGTGGAGGCAGTGGGCATGAGCCAGCTCATGCTGGTTACGTTGGAGAAGGAATGCTTACAGCT
GCTATCTGCGGAGATGTCTTTGCTTCTCCACCTGTTGATTCCATCCTGGCTGGGATTCGGGCTGTCACTGGTCCTCAGGG
ATGTCTTTTGATCGTCAAGAACTATACTGGTGACCGCTTGAACTTTGGTTTGGCTGCTGAGCAAGCGAAATCTGAAGGTT
ACAAAGTAGAGACTGTAATTGTTGGAGAGGATTGCGCTTTACCCCCACCTCGTGGTATTGCTGGACGCAGAGGGTTAGCA
GGAACCGTTCTTGTACATAAGGTGGCTGGCGCAGCAGCAGCTGCTGGTCTTTCTCTAGAAAAAGTTGCGGCCGAGGCAAA
GTGTGCGTCGGAGATGGTTGGTACCATGGGTGTTGCATTATCTGTTTGTACGCTTCCTGGGCAGGTTACATCTGACCGTC
TGGGCCAAGAGAAGATGGAGCTCGGGCTTGGAATTCATGGAGAACCTGGTGCTGCTGTGGTTGACGTTCAACCTGTGGAC
GTGGTGGTTTCACATGTTCTTCAGCAGATACTGAGTCCTGAGACCAATTATGTTCCCATTACACGCGGTAACAGAGTGGT
TCTCATGGTTAATGGCCTAGGAGGCACCCCTTTGATGGAACTTATGATTGCTGCTGGAAAAGCTGTCCCTAAACTGCAGC
TGGAATTTGGACTTGCTGTTGATAGGGTGTACACAGGGCTTTTTATGACTTCGCTCGATATGGCAGGATTCTCAATTTCA
ATCATGAAGGCTGACCAGTCAATTTTAAACCGATTAGATGCTCCAACTAAGGCTCCAAATTGGCCTGTTGGCACTGATGG
CAACCGGCCACCTGCAAAGATCCCTGTTCCTATACCCCCTTCTCGATCAGCAAAAAGTGCTGAGTCTCAGGCTCGACCTA
AAGAGCTGAGTCAACAAGGTCGAGTTCTTGAGGCAGCTATTCACGCAGCAGCAACTGTGATCATCAGTCTAAAGGATAGT
TTGAACGAATGGGATGGAAAAGTAGGCGATGGTGATTGTGGGTCAACAATGCACAGAGGTGCAACAGCTATTTTGGAAGA
CATGAAACACTATTATCCGCTCAATGATGCTGCGGAAACAGTGAATGAGATTGGTGCATCAATCAGCAGGGCCATGGGGG
GCACAAGTGGAATTATATACAATCTCCTCTGCAAGGCAGCGTACGCGGAGCTAAAAGCCAACACTGAGTCAGAAGTCACT
CCCAAATACTGGTCCAAAGCACTCAAGTCATCAATAGCTTCTGTCAGCAAATATGGTGGAGCAACTGCGGGATACAGGAC
GATGCTAGATGCGCTTATCCCAGCTTCACAAGTTCTTGAAGAGAAGCTAAGCGCTGGAGAGGACCCAATATGTGCTTTTA
TTCTGTCAGCTGAAGCAGCAACTAAAGGAGCGGAATCAACCATACAGATGCAAGCACAGGCTGGGAGATCGAGCTATGTG
TCTGCAGAGATGCTTGCAACAGTTCCAGATCCAGGTGCAATGGCTGCAGCAGGATGGTACAGTGCGGCAGCAAGAGCCGT
GAAGGAGCAGTATCAGGGGTCATCATGA