Details for Kale Locus Bo5g122600

Position : C5 ( 5`- 37232533 .. 37233737 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g122600

Protein [Map View]
MNSRRSLTSATAATMSFLLYICTTVVVTNGELQRFIEPAKSDGSVSFITIGDWGRRGDFNQSKVAYQMGRVGEKIGLDFV
VSTGDNFYDNGLFSEYDPNFKESFSDIYTAPSLQKQWYSVLGNHDYRGDSEAQLSSVLREIDSRWICLRSFVVNAELVEI
FFVDTTPFVKEYYTEEDGHTYDWRAVPSRNSYVKSLLRDLQASLKRSKATWKIVVGHHAMRSIGHHGDTKELVEELLPIM
KEYGVDLYMNGHDHCLEHISDEDSPIQFLTSGAGSKAWRGDVDPTTNNPKSVRFYYDGQGFMSARFTHTDAEIVFYNVFG
EVLHKWVTSKQLLLSSV*

DNA
ATGAATTCTCGTCGATCGTTAACGTCCGCTACGGCGGCGACTATGAGTTTTCTATTGTATATCTGCACAACCGTAGTCGT
CACCAACGGTGAGCTTCAGAGATTTATCGAACCGGCGAAGAGCGACGGTTCTGTTAGTTTTATAACCATCGGAGATTGGG
GTCGCCGCGGTGACTTCAACCAGTCTAAAGTCGCTTATCAGATGGGAAGAGTTGGAGAAAAGATAGGTTTAGATTTCGTG
GTGTCCACGGGAGATAACTTCTACGACAATGGATTGTTTAGTGAATACGATCCCAACTTCAAAGAGTCTTTCTCTGATAT
CTACACTGCTCCAAGTCTCCAGAAACAGTGGTACAGTGTCTTGGGGAACCATGATTATAGAGGTGACTCAGAGGCTCAGC
TAAGCTCTGTTCTCAGAGAAATCGACAGCCGTTGGATCTGTCTCCGATCATTCGTAGTCAACGCAGAGTTAGTCGAGATC
TTCTTCGTTGACACAACTCCTTTCGTGAAAGAATACTACACAGAAGAAGACGGTCACACGTACGACTGGCGTGCGGTCCC
ATCTCGCAATTCTTATGTCAAGTCTCTCCTCCGTGACCTCCAAGCTTCCTTAAAAAGATCCAAAGCCACGTGGAAGATCG
TCGTTGGTCACCACGCCATGAGAAGCATTGGTCACCATGGAGACACTAAAGAGCTAGTGGAGGAGCTACTTCCGATTATG
AAAGAGTACGGTGTTGATCTCTATATGAACGGACACGACCATTGTCTTGAACATATCAGTGACGAAGACAGTCCTATTCA
GTTTCTGACTAGCGGTGCTGGCTCCAAGGCTTGGAGAGGAGATGTTGACCCGACGACCAACAATCCAAAGTCTGTGAGAT
TCTATTACGATGGTCAAGGGTTCATGTCTGCTAGATTCACTCACACGGATGCAGAGATCGTCTTCTACAATGTCTTTGGT
GAGGTTTTGCACAAATGGGTTACTTCTAAACAGCTTCTTCTTTCCTCTGTTTGA