Details for Kale Locus Bo5g122590

Position : C5 ( 5`- 37230436 .. 37232068 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g122590

Protein [Map View]
MDAAATASLIRSSVLPLKTSDNGAGSMFLTASGPGFTRFGPGRQLRFRQNAFARFSRPLQSSTTRRSFVVKASASNDDAS
SSAAKPIAPLQLESPAGQFLSQILVTHPHLVPAAVEQQLEQLQTDRDSEGQNKDASSAPGTDIVLYRRIAELKENERRRT
LEEILYALVVQKFMEANVSLVPSITPSSSDPSGRVDTWPTKVEKLEKLHSSEMYEMIHNHLALILGPRMGDLASVAQISK
LRVGQVYAASVMYGYFLKRVDQRFQLEKSMKILPGGLDDSKTSVEQPENVTFKAVSSHPEVGSFAGGVSAKGFGSEIKPS
RLRTYVMSFDSETLQRYATIRSREGVGIIEKHTEALFGKPEIVITPEGTVDSSKDEQIKISFGGMKRLVLEAVTFGSFLW
DVESHVDARYHFVLN*

DNA
ATGGACGCCGCCGCGACCGCGAGTTTGATCCGATCTTCCGTCTTACCACTTAAAACTTCCGACAACGGTGCTGGATCTAT
GTTCCTCACGGCCAGTGGCCCTGGGTTCACGCGTTTTGGTCCGGGACGTCAACTTCGTTTCAGGCAAAATGCGTTTGCTA
GATTCTCGAGACCGTTGCAAAGCTCAACAACTCGGAGAAGCTTTGTGGTAAAAGCTTCAGCATCTAATGATGATGCTTCC
TCCTCTGCTGCTAAACCGATCGCGCCGCTTCAGCTTGAGTCTCCTGCTGGTCAGTTTCTGTCTCAGATTCTGGTGACTCA
TCCTCATCTCGTCCCTGCCGCTGTTGAACAGCAGCTTGAGCAGCTCCAGACTGATCGTGACTCCGAGGGTCAGAACAAAG
ATGCATCGTCCGCGCCTGGAACCGACATCGTTCTCTACAGGAGAATCGCTGAGTTGAAAGAAAACGAGAGACGAAGGACA
CTGGAAGAGATTCTATACGCATTGGTGGTTCAAAAGTTCATGGAAGCTAACGTATCACTCGTACCATCAATCACCCCATC
ATCATCAGATCCATCTGGTCGCGTTGATACTTGGCCTACCAAAGTAGAGAAACTCGAGAAGCTTCACTCATCCGAGATGT
ACGAGATGATCCACAACCATTTAGCCTTAATCCTCGGTCCCAGAATGGGCGACCTGGCTTCCGTCGCACAGATAAGCAAA
CTCAGAGTCGGCCAAGTCTACGCCGCTTCCGTCATGTACGGATACTTCTTGAAGCGGGTTGACCAAAGGTTTCAGCTCGA
AAAGTCGATGAAGATTCTCCCAGGTGGGTTGGATGATAGTAAAACAAGCGTGGAGCAGCCGGAGAACGTGACTTTTAAAG
CTGTGTCGTCTCACCCTGAGGTCGGTTCATTTGCGGGTGGAGTTAGTGCTAAGGGCTTTGGTAGCGAGATTAAACCGTCT
CGGTTAAGGACGTACGTGATGTCTTTTGATAGCGAGACGCTTCAGAGATACGCTACCATTAGATCAAGGGAAGGAGTTGG
GATCATTGAGAAGCACACTGAGGCATTGTTTGGTAAGCCTGAGATCGTGATTACTCCTGAAGGTACGGTTGATTCATCCA
AGGACGAGCAGATAAAGATCAGCTTTGGTGGAATGAAGAGGCTTGTCTTGGAGGCTGTGACTTTCGGTTCGTTTCTTTGG
GATGTTGAGAGCCATGTAGATGCAAGGTACCACTTTGTACTGAACTAA