Details for Kale Locus Bo5g122580

Position : C5 ( 5`- 37227221 .. 37229090 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g122580

Protein [Map View]
MASMSFALTRFSGLSSKSTLSPDFDHSSRRTFLPPNRVGLKISSSSSAAADSEPDLSVTVNGLKMPNPFVIGSGPPGTNY
TVMKRAFDEGWGGVIAKTVSLDASKVINVTPRYARLKTGSNGSAKTDVIGWQNIELISDRPLETMLKEFKQLKREYPDRI
LIASIMEEYSKTGWEELIDRVEQTGVDALEINFSCPHGMPERRMGAAVGQDCALLEEVCGWINAKATVPVWAKMTPNITD
ITEPARVSLKSGCEGISAINTIMSVMGIDLKTLHPEPCVEGYSTPGGYSYKAVRPIALAKVMNIAQMMKTEFGEKDYSLS
GIGGVETGYDAAEFILLGSNTVQVCTGVMVHGYGHVKTLCAELQDFMRQHNFSTIEDFRGHSLQYFTTHTDLVRRQKEAI
EQRKAERKGLKSDKDWTGDGFVKETESMVSN*

DNA
ATGGCATCCATGAGTTTCGCCTTGACTCGCTTCTCTGGACTCTCTTCTAAATCAACCTTATCACCGGACTTCGATCACTC
CTCTCGCCGGACTTTTCTACCTCCGAACAGAGTCGGTCTCAAGATCTCCTCCTCTTCTTCCGCCGCAGCAGACTCCGAGC
CTGATCTCAGTGTCACCGTAAACGGCCTGAAAATGCCGAATCCGTTCGTGATCGGGTCGGGTCCACCCGGTACCAACTAC
ACCGTCATGAAGAGAGCCTTCGATGAAGGCTGGGGAGGCGTCATCGCCAAAACCGTGTCGCTAGATGCATCCAAAGTCAT
CAACGTAACGCCTCGATACGCTCGGCTAAAAACCGGATCCAACGGCTCAGCCAAAACAGATGTGATCGGGTGGCAGAACA
TAGAACTCATCAGCGACCGACCTCTCGAAACCATGCTCAAAGAGTTCAAGCAGCTGAAACGAGAGTACCCTGATCGGATC
CTCATCGCTTCCATCATGGAGGAATACAGCAAAACCGGTTGGGAAGAGCTTATCGACCGCGTTGAGCAAACCGGTGTTGA
TGCATTAGAGATCAACTTCTCGTGCCCTCATGGTATGCCAGAGCGCAGAATGGGAGCTGCTGTTGGACAAGACTGTGCGC
TTCTGGAGGAGGTTTGCGGTTGGATTAATGCTAAAGCTACTGTTCCTGTTTGGGCTAAGATGACTCCTAATATTACTGAC
ATAACTGAGCCGGCAAGGGTATCTCTAAAATCAGGGTGTGAAGGGATTTCAGCCATCAACACAATCATGAGTGTGATGGG
AATTGATCTGAAGACACTGCATCCTGAGCCATGCGTTGAAGGTTACTCAACTCCAGGAGGCTACTCTTATAAGGCTGTTC
GCCCAATCGCGCTTGCCAAAGTTATGAACATTGCCCAAATGATGAAGACTGAGTTTGGTGAGAAAGATTACTCGCTTTCC
GGTATTGGAGGTGTTGAAACTGGCTATGACGCAGCTGAGTTCATTCTACTAGGATCAAATACTGTTCAGGTATGCACCGG
TGTGATGGTGCATGGCTATGGTCATGTGAAAACGCTATGCGCAGAGCTTCAAGATTTCATGAGACAACACAACTTCTCGA
CAATAGAAGACTTCAGAGGGCATTCTCTTCAGTACTTTACAACACACACAGACTTAGTCAGGAGACAGAAAGAAGCCATT
GAGCAGAGAAAAGCCGAGAGGAAAGGCTTGAAATCTGATAAAGATTGGACGGGAGATGGGTTCGTGAAGGAGACTGAAAG
TATGGTTTCTAACTAA