Details for Kale Locus Bo5g122540

Position : C5 ( 5`- 37207636 .. 37210066 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g122540

Protein [Map View]
MPRSTLIPSINPAHSFRHQFPLSSPSFSSPPSFMRCGNRRRGVTMAAGKDHYKTLNVGRNATLKEIKSAYRALARKYHPD
MNKNPGAEDKFKQISAAYEVLSDEEKRSAYDRFGEAGLDANFNASQDASQGVDPFDLYSAFFGGGSDGFFGEMGDSGGMG
FDFMNKRSLDLDIRYDMRLSFEESVFGVKREIDVSYLATCDGCGGTGAKSSKDVKQCSNCGGKGRVMDTQRTPFGIMSQV
SNCSKCGGDGRIITDKCRMCNGNGRLRSSKKMDLVVPPGVSDRATMRMRGEGNVDKRSGRAGDLFIVLQVAEKRGIRREG
LNLYSKITIDFTDAILGTVTKVETVEGTMDLRIPPGTQPGDTVKLYRKGVPDTDRPSVRGDHCFEVKVLIPKNLSERERK
LVEEFSSLRRSSSSTETRQEEHRFDSESREKPSLWQKMKSFIRPEEDSKTKFGTMSLNSSVPLRRMNEAGTSIVFPFLAL
CVIASAVALVQKKGNRLKEKKEI*

DNA
ATGCCTCGCTCTACTTTGATTCCATCCATAAACCCAGCTCACAGCTTCCGTCATCAGTTCCCGCTATCCAGTCCTTCGTT
CTCTTCTCCCCCCAGTTTTATGCGATGCGGAAATCGCCGTCGTGGGGTCACCATGGCCGCCGGGAAGGATCACTACAAAA
CTTTGAATGTCGGCCGCAACGCCACCTTGAAGGAGATCAAGAGCGCGTACAGAGCACTCGCTCGCAAGTATCATCCGGAC
ATGAACAAGAACCCAGGAGCTGAAGATAAGTTCAAACAGATCAGTGCTGCTTATGAGGTGTTATCTGACGAGGAGAAGAG
ATCCGCGTATGATCGCTTTGGCGAGGCGGGTTTAGATGCCAATTTCAATGCTTCACAGGATGCTTCTCAAGGAGTGGACC
CATTTGATTTGTATAGTGCATTCTTTGGAGGTGGTTCTGATGGATTTTTTGGAGAAATGGGTGATTCTGGAGGCATGGGT
TTTGACTTCATGAATAAGAGAAGCCTTGACCTTGACATCCGGTATGATATGCGGTTGAGCTTTGAAGAGTCTGTTTTTGG
AGTAAAGCGTGAGATTGATGTTTCTTATTTAGCAACGTGTGATGGATGTGGAGGAACAGGTGCCAAATCTAGTAAGGACG
TTAAACAGTGTAGCAATTGTGGTGGTAAAGGGCGCGTCATGGACACTCAGAGAACACCCTTTGGAATCATGTCTCAGGTT
TCCAATTGCTCAAAATGTGGTGGTGATGGGAGAATCATAACTGATAAGTGTCGAATGTGCAATGGCAACGGGAGACTACG
GTCTAGTAAAAAGATGGATCTTGTTGTCCCTCCTGGTGTCAGCGACAGAGCCACAATGCGGATGCGAGGAGAAGGTAACG
TGGACAAGAGAAGTGGACGAGCTGGAGATCTGTTCATCGTGCTTCAGGTTGCTGAGAAGCGTGGGATCCGGAGGGAAGGG
CTTAATCTATACTCCAAGATCACCATAGATTTCACAGATGCAATACTTGGGACTGTCACAAAGGTAGAAACAGTTGAGGG
AACAATGGATCTTCGGATTCCGCCTGGAACTCAGCCAGGTGACACTGTGAAATTATATAGGAAAGGAGTTCCAGACACGG
ATAGACCTTCAGTTCGAGGTGATCATTGCTTTGAAGTGAAGGTTTTGATCCCCAAAAACCTAAGCGAGAGGGAACGCAAG
TTGGTAGAGGAATTCTCGTCGCTTAGAAGATCTAGCAGTAGTACTGAAACTCGTCAAGAGGAGCATAGATTTGACTCAGA
GTCCAGAGAAAAACCGTCTTTGTGGCAAAAAATGAAGAGTTTCATAAGGCCAGAAGAAGATTCAAAGACGAAGTTTGGGA
CAATGAGCTTGAACTCCTCAGTGCCACTACGAAGAATGAACGAGGCAGGGACGTCGATTGTTTTCCCCTTCTTGGCTCTG
TGCGTTATAGCCTCGGCTGTTGCATTGGTTCAGAAAAAGGGTAATCGCTTGAAAGAAAAGAAAGAAATCTAA