Details for Kale Locus Bo5g122520

Position : C5 ( 5`- 37196101 .. 37202102 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g122520

Protein [Map View]
MVFKNKLFFSSKKSGSSSPDSSNSPRSVGSNSPNPSDKKKSKSASKDESPISSPSSLGGFGCKQASSIKDGLKKNKGKEV
PSPHSIGKSNLSPKNEGGPAFVSPIMASSLGLNRIKTRSGPLPRESVFNFRSDEKTPPLLCTSKLSKMATDTGSGFGSGD
KKKEAGSVMLRFEENMSRAQASDRDSSMSPDTGGPPKSLSPTLPPSGSRLQNAASSSGAGRSGPIKSSDFCTPENSYEWE
NPKESESPRYQALLRMTSAPRKRFPGDIKSFSHELNSKGVRPFPLWKPRRSNNVEEILVLIRAKFDKAKEEVNSDLKVFA
ADLVGILEKNAESHPEWEETFEDLLILARSCAMTTPGDFWLQCEGIVQDLDDRRQELPQGVLKQLHTRMLFILTRCTRLL
QFHKESWGEEEQVVQLRQSRVLHSIEKIPPSGPGRSSSAAKVLKMPPSTKKAYSQEQRGLQWKEDVVVRSVPPLSPPEND
VLKESESPANIDRMSSWKKLPSPVLKTVKEAPALEEQNHNKVEPPNLVRNRHAAVSTLSGPPAKDSHEHSPKHRHNISWG
YWGEQPLVSEESSIMCRICEEEVPTTHVEDHSRICTLADKYDQKGLSVDERLMAVAGTLDKIAETFRHKDSLAAGESPDG
MKVSNSNLTQECDVLSPRLSDWSRRGSEDMLDCLPETDNSVFMDDLRGLPLMSCKTRFGSKSDQGMTTSSASSMTPRSPI
PTPRPDPIEMILGGKGTFHDHDEYPQMSELADIAKCAADAIPGDEQSIPFLLSCLGDLRVVIDRSKFDALTVETFGTRIE
KLIREKYLQICELLDDEKVDLSSTVIDEDAPLEDDVVRGLRTSPVHPRDRTSIDDFEIIKPISRGAFGRVFLAKKRTTGD
LFAIKVLKKADMIRKNAVESILAERDILINVRNPFVVRFFYSFTCRDNLYLVMEYLNGGDLYSLLRNLGCLEEDIVRVYI
AEVVLALEYLHSEGVVHRDLKPDNLLIAHDGHIKLTDFGLSKVGLINSTDDLSGPGISLLDEEESRLPTSEHQLERRKKR
SAVGTPDYLAPEILLGTGHAATADWWSVGIILFELIVGIPPFNAEQPQQIFDNILNRNIPWPHVPEEMSAEAHDIIDRFL
TEDPHLRLGARGAAEVKQHVFFKDINWDTLARQKAAFVPASESAIDTSYFRSRYSWNTSDEQFFPSGEVQDYSDADSLSG
SSGCSSNGHEEGEVEESDGQAESESGVPVDYSFSNFSFKNLSQLASINYDLLSKGWKDEPQPNSRPK*

DNA
ATGGTGTTCAAGAACAAGCTCTTCTTCTCCTCAAAAAAATCCGGATCGTCGAGCCCCGATAGCTCCAACAGCCCCAGATC
CGTCGGCTCCAACTCTCCTAATCCATCAGACAAGAAGAAGTCGAAATCCGCTTCCAAGGATGAATCCCCGATCTCTAGCC
CGAGCTCCCTCGGCGGCTTCGGTTGTAAGCAGGCGTCGTCGATTAAAGACGGTTTGAAGAAGAATAAGGGAAAAGAAGTT
CCGTCTCCTCACTCTATCGGAAAATCGAACTTGTCTCCGAAGAACGAAGGAGGACCGGCGTTTGTTTCTCCGATCATGGC
GTCGTCTCTGGGATTGAACCGGATCAAGACGAGATCGGGGCCTTTGCCTCGGGAAAGTGTTTTCAATTTTCGGAGTGATG
AGAAAACTCCGCCTCTGCTGTGTACGAGTAAGCTCTCGAAGATGGCTACTGATACTGGCTCTGGATTTGGTAGCGGGGAT
AAGAAGAAGGAAGCTGGGAGTGTGATGCTGAGGTTTGAAGAGAACATGAGTCGCGCTCAAGCGAGTGATCGTGATAGTAG
TATGTCTCCTGATACTGGAGGACCACCGAAGAGCCTCAGCCCTACGTTGCCGCCTTCAGGATCTCGATTGCAGAATGCAG
CATCCTCATCGGGAGCTGGCCGCTCTGGCCCTATAAAAAGTTCAGACTTCTGCACCCCAGAGAATTCGTATGAATGGGAA
AATCCAAAAGAGTCGGAGTCACCACGTTATCAAGCCTTACTTCGTATGACCAGTGCTCCTCGGAAGAGGTTTCCTGGTGA
CATCAAAAGCTTTTCTCATGAACTGAACTCTAAAGGTGTACGGCCCTTTCCATTGTGGAAGCCTCGTAGGTCGAACAATG
TGGAGGAAATATTGGTTCTCATTCGGGCCAAATTTGATAAAGCAAAGGAAGAAGTAAACTCTGACCTTAAGGTATTTGCT
GCGGACCTGGTGGGAATTCTTGAGAAAAATGCAGAAAGCCATCCTGAGTGGGAGGAAACATTTGAAGACTTATTAATTTT
GGCTCGCAGTTGTGCTATGACTACTCCTGGAGATTTCTGGCTTCAGTGTGAAGGCATAGTTCAAGATTTAGATGATAGAC
GTCAAGAGCTTCCTCAGGGCGTTCTCAAACAGCTTCATACTCGGATGCTTTTTATACTTACCAGATGTACGAGATTGCTA
CAGTTTCATAAGGAAAGTTGGGGAGAAGAGGAACAAGTTGTACAACTACGTCAGTCCAGAGTTTTGCATTCTATAGAAAA
AATACCTCCCAGCGGACCAGGAAGGAGTTCAAGTGCTGCAAAGGTCTTAAAGATGCCACCATCCACCAAGAAAGCTTATA
GTCAGGAGCAGCGTGGTTTGCAGTGGAAGGAGGACGTGGTTGTACGCTCAGTTCCTCCCCTCTCTCCTCCTGAAAATGAT
GTTCTTAAAGAATCTGAATCTCCTGCAAACATTGATAGAATGTCTTCCTGGAAGAAACTTCCATCTCCAGTACTGAAAAC
TGTGAAAGAAGCGCCAGCATTAGAAGAGCAGAATCATAACAAAGTTGAACCTCCAAATCTGGTTAGAAATCGACATGCGG
CTGTCTCTACTCTCAGCGGCCCTCCCGCAAAAGATTCTCATGAACATTCCCCCAAGCATCGGCACAATATATCTTGGGGT
TACTGGGGGGAACAGCCACTTGTTTCGGAAGAAAGTTCAATAATGTGCCGTATCTGTGAGGAGGAGGTTCCCACTACCCA
TGTTGAAGATCACTCTAGAATTTGTACATTAGCTGATAAATATGACCAGAAAGGACTGAGTGTTGATGAGCGGCTTATGG
CAGTTGCTGGAACTCTAGACAAGATAGCAGAGACCTTCAGGCATAAGGATAGCTTAGCAGCTGGAGAAAGCCCAGATGGT
ATGAAAGTATCCAATTCAAATTTGACTCAAGAGTGTGATGTTCTCTCGCCAAGGTTGAGTGATTGGTCGCGGAGAGGGTC
AGAAGACATGCTTGACTGTCTCCCAGAGACTGATAATTCAGTTTTTATGGATGATCTGAGAGGTTTACCCTTAATGTCAT
GTAAAACCCGTTTTGGTTCCAAGTCTGATCAAGGCATGACAACCTCATCTGCCAGTAGCATGACTCCTAGATCCCCAATT
CCGACCCCTAGACCTGATCCAATTGAAATGATTCTAGGAGGCAAGGGTACTTTCCATGATCACGATGAATATCCACAGAT
GAGCGAACTTGCTGACATTGCAAAATGTGCAGCAGATGCCATTCCGGGTGATGAACAATCAATTCCATTTTTACTTTCTT
GTCTTGGGGATCTGAGGGTTGTCATAGACCGTAGTAAGTTTGATGCCCTTACAGTAGAGACTTTTGGGACTCGCATAGAA
AAGTTAATCCGGGAGAAATATCTGCAGATCTGTGAACTTCTGGATGATGAAAAAGTTGACTTATCAAGCACTGTAATTGA
TGAAGATGCTCCTTTAGAAGATGATGTTGTTCGAGGCTTGAGGACCAGTCCAGTACACCCGCGCGACCGCACATCCATAG
ATGATTTTGAGATCATAAAACCAATAAGTCGGGGAGCTTTTGGGAGAGTTTTTTTGGCTAAAAAGAGAACAACAGGCGAT
CTATTTGCAATCAAGGTTCTGAAAAAGGCAGATATGATCCGCAAGAATGCTGTTGAAAGTATACTAGCCGAACGTGATAT
TTTGATCAATGTCCGCAATCCCTTTGTGGTACGTTTCTTCTATTCTTTCACATGCCGGGACAACCTGTATCTTGTGATGG
AGTATTTGAATGGAGGGGACCTGTATTCGTTATTGAGAAATTTGGGTTGCTTAGAGGAAGATATTGTCCGTGTGTATATT
GCCGAAGTTGTCCTTGCTTTGGAGTATTTGCATTCTGAGGGTGTTGTTCATCGTGATTTGAAGCCTGATAATTTGTTGAT
TGCGCATGATGGTCATATTAAGTTGACAGATTTTGGGCTTTCCAAAGTTGGTCTCATCAACAGCACCGATGACCTGTCTG
GTCCTGGGATATCTCTGCTTGATGAGGAGGAATCACGATTACCGACATCCGAGCATCAGCTTGAAAGGCGCAAGAAACGG
TCTGCTGTGGGTACTCCTGACTACTTAGCTCCAGAAATTCTTTTGGGGACGGGACATGCTGCAACTGCGGATTGGTGGTC
TGTTGGAATCATTCTCTTTGAACTCATTGTGGGAATTCCACCTTTCAATGCTGAGCAACCTCAGCAAATATTTGACAATA
TTCTAAATCGTAACATACCATGGCCTCATGTCCCGGAAGAAATGAGTGCTGAAGCCCACGATATTATAGACCGATTTTTA
ACAGAAGATCCTCATCTGAGACTTGGAGCTAGAGGTGCTGCTGAGGTCAAGCAGCACGTCTTCTTTAAAGACATCAACTG
GGATACACTAGCAAGGCAAAAGGCTGCATTTGTTCCAGCTTCAGAGAGTGCAATTGACACTAGTTACTTCAGAAGTCGCT
ACTCGTGGAACACATCGGATGAGCAATTTTTCCCATCGGGTGAGGTTCAAGATTATAGTGATGCTGATAGCTTGAGTGGC
AGCAGTGGTTGCTCGAGCAACGGCCATGAGGAGGGAGAGGTTGAAGAAAGCGACGGACAAGCAGAGTCCGAGTCTGGCGT
ACCTGTGGATTACTCTTTCAGTAATTTCTCGTTTAAGAACCTGTCGCAGTTGGCATCAATCAACTACGATCTTCTATCTA
AAGGCTGGAAAGATGAACCACAACCAAACTCGCGTCCCAAGTAA