Details for Kale Locus Bo5g121480

Position : C5 ( 5`- 37118206 .. 37121030 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g121480

Protein [Map View]
MERDFLGLGSKNSPITVKEETSESSRDSAPNRGMNWSFSKKGSAASSQFLSFRPSQDDRHRKPGNYHLTHSGSFMPSSVA
DGYDSNRNTPYSSVQGARMFPNSHQQQESITVSMARPGLQSHYPPGGKSFMSSGINSQPFVGVPIMAPPISVLPAPGSIV
GTTDIRSSSKPLGSPAQLTVFYAGSVCVYDDISPDKAKAIMLLAGNGSSMPQAFSPPQTHQQVVHHARASVDSSAVPPSF
MPTASYLSHEGGSSTYGLGAVKATTGFTSTYHNNQTVKPQTVALPQARKASLARFLEKRKERVTSASPYCLDKKSPTDCR
TPISECISSSFSSAT*

DNA
ATGGAGAGAGATTTTCTCGGGCTGGGTTCGAAAAATTCGCCGATCACTGTGAAGGAGGAAACAAGCGAAAGCTCCAGAGA
TTCAGCTCCCAATAGAGGAATGAACTGGTCATTCTCAAAGAAAGGCTCTGCTGCTTCTTCTCAGTTTCTATCTTTCAGGC
CATCTCAAGATGACAGACATAGAAAGCCTGGAAACTATCATCTGACTCACTCTGGTTCCTTCATGCCATCATCAGTAGCA
GATGGTTATGATTCTAACCGGAACACTCCTTACAGTTCTGTACAGGGAGCCAGGATGTTCCCTAACTCCCATCAACAGCA
AGAATCTATCACAGTTTCCATGGCCAGGCCGGGTCTCCAGTCTCATTATCCACCAGGAGGAAAAAGCTTCATGAGCAGTG
GCATAAACTCACAACCTTTTGTAGGAGTTCCAATCATGGCACCTCCAATCTCAGTCCTTCCTGCTCCAGGTTCCATTGTA
GGGACAACTGATATTAGATCTTCTTCCAAGCCATTAGGATCACCAGCTCAGTTGACCGTCTTTTATGCCGGTTCAGTTTG
TGTTTATGATGACATATCTCCTGATAAGGCCAAGGCGATAATGTTGCTAGCTGGAAACGGTTCCTCTATGCCTCAAGCCT
TCTCACCACCTCAAACTCATCAACAGGTGGTCCACCATGCTCGTGCCTCTGTTGATTCTTCAGCTGTGCCTCCTAGCTTC
ATGCCTACAGCCTCTTATCTTAGCCATGAAGGTGGAAGTAGCACATACGGACTCGGAGCAGTAAAAGCAACGACAGGCTT
TACATCAACATACCACAACAACCAAACTGTAAAGCCTCAAACAGTGGCTTTACCTCAGGCTCGCAAAGCATCTCTGGCTA
GGTTTTTAGAGAAACGCAAAGAAAGGGTCACAAGTGCATCGCCATATTGCTTGGACAAGAAGTCACCAACAGATTGTCGT
ACACCAATATCTGAATGCATAAGTTCGTCATTCAGCTCTGCAACCTAA