Details for Kale Locus Bo5g121470

Position : C5 ( 5`- 37114944 .. 37117282 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g121470

Protein [Map View]
MMDANQVAELRRFIEQLKLNPSLLHDPSLTFFKDYLRSLGAQVPKIVKTERDYEDTAETKPSFSPSYDDDEVTESDVELD
DSDVVEPDNEPPQPMGDPTAEVTDEDRDAAQLEKSKAMEAISQGKFDEGIDHLTKAIMLNPSSAILYATRATVFLAVKKP
NAAIRDADMALQFNPDSAKGYKARGMARAMLGQWEEAAADLHVASKLDYDEEIGSALKKVEPNAKRIEEHRRKYQRLRKE
KELQRAERERREQQEAQEREALSALKDGQVISIHSTSELEAKTKAAKKASRLLIMYFTATWCGPCRYMSPVYTNLATQHP
RVVFLKVDIDEANDVAAAWNISSVPTFCFIRDGKQVDKVVGADKGSLEKKIAQHSSSK*

DNA
ATGATGGATGCGAATCAAGTAGCAGAGCTCCGAAGATTCATCGAGCAGCTGAAACTGAATCCTTCTCTCCTCCACGATCC
TTCTCTGACTTTCTTCAAAGATTATCTCCGAAGTTTAGGAGCTCAAGTCCCTAAGATAGTGAAGACTGAAAGAGATTATG
AGGATACGGCTGAGACTAAACCCAGTTTCTCTCCTAGCTATGATGATGATGAAGTTACCGAGTCTGATGTTGAATTGGAT
GATTCTGATGTTGTTGAGCCAGACAATGAGCCTCCTCAGCCGATGGGAGATCCTACAGCTGAAGTGACGGATGAAGATAG
GGATGCTGCTCAGTTAGAGAAGAGCAAAGCCATGGAAGCAATCTCTCAAGGAAAGTTCGACGAAGGTATTGATCATCTAA
CAAAGGCCATCATGCTGAACCCCTCTTCAGCTATTCTCTATGCCACTAGAGCTACTGTGTTTCTAGCAGTCAAGAAGCCA
AATGCTGCAATCCGGGATGCGGACATGGCGTTACAGTTCAACCCTGATTCAGCTAAGGGGTACAAAGCAAGAGGTATGGC
TAGGGCCATGTTAGGCCAGTGGGAAGAAGCTGCGGCTGATCTTCATGTAGCCTCAAAATTAGATTACGACGAGGAGATTG
GGTCGGCACTTAAGAAGGTTGAGCCCAATGCAAAGAGAATCGAAGAACACCGCAGGAAATATCAACGTCTGAGGAAAGAA
AAGGAGCTTCAAAGGGCTGAACGCGAGAGAAGAGAACAGCAAGAAGCCCAGGAGCGAGAAGCTCTGTCTGCACTTAAAGA
CGGACAAGTGATTAGCATCCACTCTACGAGCGAGCTAGAAGCAAAGACAAAGGCTGCAAAGAAGGCATCGCGTCTGCTAA
TCATGTACTTCACAGCAACATGGTGTGGACCGTGCCGTTACATGTCTCCTGTGTACACAAACCTGGCTACGCAACACCCG
AGAGTAGTCTTCTTGAAAGTTGACATAGATGAGGCCAATGACGTGGCTGCTGCTTGGAACATAAGCAGCGTCCCGACCTT
TTGCTTCATCAGAGATGGCAAGCAGGTGGACAAAGTTGTGGGAGCCGATAAAGGTTCGCTTGAGAAGAAGATTGCACAGC
ACTCTTCTTCTAAGTAA