Details for Kale Locus Bo5g121460

Position : C5 ( 5`- 37113781 .. 37114387 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g121460

Protein [Map View]
MDGNMRRLPPWMIAGASSGVTATSNRTDDREIKQEAESPKTKKKRKTRRETDDSEEPEKVEIRKRGRVGRKIKEEEAKPS
IPDDVKSPEIIQSVTSPEDEEDLTVDDLLSFAQEYVKGEEEDQALSTSESMVVDVNDGSNMKASQGETNGTRDPTSDDMI
SLLLGPFFNTRK*

DNA
ATGGATGGGAATATGAGGCGGTTACCACCGTGGATGATCGCCGGCGCGTCATCCGGTGTAACAGCTACAAGCAATCGAAC
AGACGATCGTGAAATAAAACAGGAAGCAGAATCTCCCAAGACCAAGAAGAAGCGTAAAACTCGAAGAGAGACAGATGACT
CAGAGGAACCCGAAAAGGTGGAGATCAGGAAAAGAGGAAGAGTTGGTAGGAAAATCAAAGAAGAAGAGGCTAAGCCTAGT
ATTCCCGATGATGTTAAGAGTCCCGAGATTATTCAATCCGTGACTAGTCCAGAAGATGAGGAGGATCTCACGGTTGATGA
TTTATTAAGCTTTGCTCAAGAGTACGTCAAAGGTGAGGAAGAAGACCAGGCATTGTCAACATCTGAATCAATGGTGGTTG
ATGTTAATGATGGATCAAACATGAAAGCCTCTCAAGGAGAAACAAATGGAACCAGAGATCCAACATCAGATGACATGATC
AGTTTGCTATTGGGTCCTTTTTTCAATACTCGAAAATAA