Details for Kale Locus Bo5g121450

Position : C5 ( 5`- 37109357 .. 37111672 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g121450

Protein [Map View]
MHPCAEDQSSANLWSHFISAVADKSSWRQKPFYFTSPRRSKILTRETKKKKKKMATSLSKILTRSKAHRHMFSATTTIST
SHSIQRQFSAVADSSFSTSAALGSQTSPPAPPQDKKRGSKWTQLLLFLPGAITFGLGSWQIVRREEKIKTLEYQQQRLKM
EPMKLNADHPPDKNLDALEFRRVSCKGVFDEQKSIYLGPRSRSISGVTENGYYVITPLMPIPGDLDSMQSPILVNRGWVP
RSWRDKSQESTESDSVTNESTIAKPLSSEQHSWWKFWSKTPVIPKEHVSAVKPVEVVGVIRGGENPSIFVPANDPSTGQW
FYVDVPAMARAIGLPEDTIYVEDVHEDIDRSRPYPVPKDINTLIRSKVMPQDHLNYCITWYSLSAAVTFMAYKRLKPKSA
RRYAFL*

DNA
ATGCACCCGTGCGCAGAGGATCAAAGCTCTGCAAATCTCTGGAGCCATTTCATTTCCGCTGTAGCAGACAAGTCGTCGTG
GAGGCAAAAACCCTTTTACTTCACTTCTCCCCGGCGATCAAAAATCTTGACGAGAGAGACGAAGAAGAAGAAGAAGAAGA
TGGCGACATCTTTGTCTAAAATCCTAACCAGATCGAAAGCTCACCGCCACATGTTCTCTGCCACAACCACTATCTCTACC
TCCCATTCCATCCAGAGACAGTTCTCCGCCGTCGCCGACTCTTCTTTCTCTACCTCCGCCGCGCTTGGAAGCCAAACGAG
TCCCCCAGCTCCACCGCAAGACAAGAAACGAGGGTCGAAGTGGACACAACTGCTGTTGTTCTTGCCTGGAGCGATTACCT
TCGGTCTCGGTTCATGGCAAATCGTCAGAAGAGAAGAAAAGATCAAAACACTGGAGTACCAACAACAACGGTTGAAAATG
GAACCAATGAAGCTAAACGCAGACCATCCTCCTGATAAGAACCTTGATGCCTTGGAATTTAGACGGGTTAGTTGCAAGGG
CGTGTTTGACGAGCAAAAGTCTATCTATTTGGGTCCACGGTCTAGGTCCATATCGGGAGTGACTGAAAATGGATACTATG
TCATCACACCTCTAATGCCAATCCCTGGTGACCTGGATAGCATGCAGTCGCCTATTCTGGTGAATCGCGGATGGGTTCCT
CGTAGTTGGAGAGACAAGTCACAAGAATCCACCGAGTCAGACTCCGTTACAAATGAGTCAACAATAGCCAAACCACTCTC
CAGTGAGCAACATTCATGGTGGAAATTTTGGTCTAAGACGCCAGTGATTCCCAAGGAGCATGTGTCAGCGGTTAAGCCTG
TAGAAGTTGTTGGTGTGATCAGGGGAGGGGAGAACCCGAGCATATTTGTTCCGGCCAATGATCCAAGCACAGGGCAGTGG
TTCTACGTAGACGTTCCTGCAATGGCTCGTGCCATAGGTCTTCCTGAAGACACAATTTACGTAGAGGACGTTCACGAGGA
CATAGATCGGAGTAGACCGTATCCTGTCCCGAAAGACATCAACACTTTGATCCGGAGTAAAGTCATGCCACAGGATCATC
TCAACTACTGTATAACATGGTACTCTCTCTCGGCAGCTGTCACTTTCATGGCTTACAAGAGGCTCAAACCAAAGTCTGCC
CGCAGATATGCTTTTCTTTGA