Details for Kale Locus Bo5g121440

Position : C5 ( 5`- 37095115 .. 37100263 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g121440

Protein [Map View]
MAIVTGDRYLENLERFLEENADSLIDATDVLKLNPAGLHYVHLRLESLREVERMLSGAPVDYLRAYVSDIGDYRALEQLR
RILRLLPSLKVVSSLPSPARDPTPLSLLPFARLKVLELRGCDLSTSSAKGLLELRHTLEKLICHNSTDALRHVFASRIAE
IKDSPQWNKLAFVSCACNRLLLMDESLQLLPAVESLDLSRNKFAKVDNLRRCSKLKHLDLGFNQLRKISHLSEVSCHLVK
LVLRNNALTTLRGIENLKSLEGLDVSFNIISDFSELEFLGSLSFLTDLWLEGNPFCCARWYRANVLSYVARPNDLKLDGK
QIGNREFWKRQVVVTRRKTQPASYGFYSPAREEADDEGSFNRKKSQSKIYRLASIDTEEESTYVNSDQESASCELETQSK
EENIKSDHEDDIFGLISKVEKLKKERSVLWLREVKEWMDHPSEDFVDVRKDGWSIDSEKKYYTKNGKNPKHHKEALRYPP
GPLPGFQITDLNQKDQAYLLDGKPDEKGNMSTLDATHDITGSFSPSTYMQPPPHYQKDVLHRRHNLVEEILQLSADSYSV
ASSDSSSSCSENENYDSEQSNPEQDMLVDHLNENSPGEEILGSEKGTSLLDSQPEKSSIIKTWRIDESFKAKTNNIISGL
HNSELASGVNHIYNWFDKRKSKRKPKKRVVTLLVDNSVISSGETSHRSDADISDSGEDGCVSDHLQEGSLTMACNSKRTT
RFWGAEKTPEVMGGLVDEYITTTLSDSSIDETCRTYVCCDCILRQESTYTQQEVVLLRSSQDKLCVLFVDVSTDSQDRNL
SLLCSHAINDIQDVSVGLGLQVVRLRFKEGTEYIFKTESIEKTTVLLNITKVLDSQATESKCLGSLENIQMEMFEKEICG
GLKLSIFQYSVLQFQRSTLGEMSWLPRSLFVVDGHLFICIEDFRQLSSPPKDTSSAPYFSLDSSCSISDIFEMAIESRGS
SCLSLKIKQKNSTFQARPNRTATSATWKLKLFSIECVLKFVSLVKGLHPDSPEFPLLVRHLG*

DNA
ATGGCGATCGTGACGGGAGATCGATACCTGGAGAATCTCGAGAGGTTCCTCGAAGAAAACGCCGATTCGCTCATCGACGC
CACCGATGTCCTCAAGCTCAACCCCGCGGGGCTTCACTACGTCCATCTCCGCCTCGAATCTCTCCGCGAAGTCGAGCGTA
TGCTCTCCGGAGCTCCCGTTGACTATCTCCGCGCCTACGTCTCCGATATCGGTGATTACCGCGCCTTAGAGCAGCTCCGA
CGTATCCTCCGCCTCCTCCCTTCTCTGAAAGTCGTCTCCTCGCTTCCTTCGCCGGCTCGTGATCCCACGCCGCTCTCTCT
TCTTCCCTTTGCGAGGCTTAAGGTCTTGGAGCTGCGCGGGTGTGATTTGTCCACTTCGTCTGCTAAGGGATTGCTCGAAC
TCAGGCACACCTTGGAGAAGTTGATCTGCCACAATTCCACTGATGCGTTGCGGCATGTGTTTGCTAGTAGAATCGCCGAG
ATAAAGGATTCACCACAGTGGAATAAGTTGGCTTTCGTTTCTTGCGCTTGTAACCGTCTCTTGCTTATGGATGAGTCGTT
GCAACTTCTCCCAGCTGTTGAGTCGCTTGATCTGAGTCGGAACAAGTTTGCGAAGGTGGATAATCTTCGGAGGTGTTCCA
AGCTGAAACACCTTGATCTAGGTTTCAATCAACTCAGAAAAATCTCTCACTTGAGCGAGGTATCATGTCACCTTGTTAAA
CTTGTTTTGAGGAACAACGCTCTAACTACATTGCGTGGGATTGAGAATTTGAAGTCACTTGAAGGCCTTGATGTTTCCTT
CAATATTATTTCAGACTTCTCAGAATTGGAATTCCTTGGGAGTCTTTCATTCTTGACAGACTTGTGGCTGGAAGGAAATC
CGTTTTGCTGTGCTCGATGGTACAGGGCAAATGTCCTCAGCTACGTTGCTCGTCCAAATGATTTAAAGCTAGATGGCAAA
CAAATTGGGAATAGAGAATTTTGGAAGAGGCAGGTTGTTGTTACCCGTAGGAAAACTCAGCCTGCTAGCTATGGGTTCTA
CTCTCCGGCTAGAGAGGAAGCTGATGATGAAGGAAGCTTCAATAGAAAAAAGTCACAGTCGAAAATCTACCGGCTCGCGT
CTATTGACACTGAGGAAGAGAGTACTTATGTAAATTCTGACCAAGAGTCTGCTTCATGTGAACTCGAGACTCAAAGCAAA
GAGGAGAATATCAAGTCCGATCACGAAGATGATATCTTTGGTCTAATAAGTAAAGTTGAAAAGTTGAAGAAAGAACGTTC
GGTTCTTTGGCTGCGAGAGGTTAAGGAGTGGATGGATCATCCGTCAGAGGATTTTGTGGATGTCAGAAAAGACGGCTGGA
GTATTGATTCAGAGAAAAAGTACTACACAAAGAATGGAAAAAACCCGAAGCATCACAAGGAAGCATTGAGATATCCACCA
GGGCCTTTACCCGGTTTCCAAATTACAGATCTAAATCAGAAGGATCAAGCATATCTTCTTGATGGGAAGCCAGATGAAAA
AGGAAACATGTCAACATTGGATGCTACTCACGATATAACAGGATCATTTTCACCCTCAACATATATGCAACCACCCCCTC
ACTACCAAAAGGATGTCTTACACCGACGTCATAACCTGGTGGAAGAAATCTTGCAGCTATCAGCAGATTCTTACTCAGTA
GCATCGTCTGATAGCTCGAGCAGCTGCAGTGAAAATGAAAATTATGACTCTGAGCAATCAAATCCTGAACAAGATATGTT
GGTGGATCATCTTAATGAGAATAGCCCCGGCGAGGAGATTCTGGGATCTGAAAAAGGCACAAGCTTGCTTGATTCTCAAC
CAGAAAAAAGTAGCATAATAAAGACTTGGAGGATAGATGAATCGTTCAAAGCAAAGACCAATAATATTATTTCTGGACTA
CATAATAGTGAGCTTGCTTCCGGTGTTAATCATATTTATAATTGGTTTGACAAAAGGAAAAGCAAGAGGAAGCCTAAAAA
GAGAGTTGTTACTCTATTGGTGGATAATAGTGTCATAAGTAGCGGAGAAACATCTCATAGAAGTGATGCTGATATCAGTG
ATTCTGGTGAAGATGGGTGTGTTTCTGATCATTTGCAAGAAGGTTCATTGACTATGGCTTGTAATAGTAAGAGAACTACT
AGATTTTGGGGTGCTGAAAAAACCCCTGAAGTAATGGGTGGTTTAGTGGACGAGTATATTACAACAACGCTGTCAGATTC
CAGCATTGATGAGACTTGTAGGACTTACGTATGTTGTGATTGCATACTACGGCAAGAATCCACCTACACGCAACAGGAAG
TAGTGTTGCTGCGGAGTAGCCAAGATAAATTGTGTGTGCTGTTCGTGGATGTTTCTACTGATTCACAAGACAGAAATTTA
AGTTTATTGTGTTCGCATGCTATAAATGATATACAAGATGTCTCAGTTGGGCTAGGACTTCAAGTTGTGAGGCTACGCTT
TAAGGAGGGCACGGAGTACATTTTCAAAACAGAGAGCATCGAGAAAACAACAGTTTTACTCAATATCACTAAAGTGTTGG
ATTCTCAAGCTACGGAATCTAAATGTTTGGGAAGTTTGGAGAATATTCAAATGGAAATGTTTGAGAAAGAAATATGTGGT
GGTTTAAAGCTGAGTATATTCCAGTATAGTGTTCTCCAGTTTCAGAGAAGCACTCTTGGAGAGATGTCATGGCTTCCACG
GTCACTATTTGTGGTAGATGGACATCTTTTCATATGCATTGAAGACTTCAGGCAGCTGAGTTCTCCGCCAAAGGATACTT
CTTCGGCTCCATATTTCTCACTTGACTCGAGCTGCTCCATCTCCGACATTTTTGAGATGGCTATTGAATCCCGGGGAAGC
TCATGCTTGTCACTGAAGATCAAGCAGAAGAATTCCACATTTCAAGCCAGACCAAACAGAACAGCGACTTCAGCAACATG
GAAGCTCAAATTATTCAGCATCGAGTGTGTACTCAAATTCGTGTCTCTAGTCAAAGGACTTCATCCGGATTCACCAGAAT
TCCCGTTGCTCGTAAGGCATTTGGGTTAG