Details for Kale Locus Bo5g121400

Position : C5 ( 5`- 37070172 .. 37071791 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g121400

Protein [Map View]
MQVKISNFGATITSLSVPDNNGKLADVVLGFDSVDPYVNGLAPYFGCIVGRVANRIKEGKFSLNGVDYTLPINNGPNSLH
GGNNGFDKKTWEVAGHKKDGDKPFITFKYHSADGEEGYPGAVTVTATYTLTSATTMRLDMEAVPENKDTPISLAQHTYWN
LSGHDSGNILDHRIQIWGSHITPVDQHSVPTGELLPVKGTPFDFTEEKRIGDRIGEVGIGYDHNYVLDCADQEKDGLKHA
AKLRDGESSRVMDLWTDAPGVQFYTGNYVDGVVGKGNAVYGKHSGVCLETQGFPNAINQKSFPCVVVKAGEKYKHTMLFE
FSA*

DNA
ATGCAGGTCAAGATCTCTAATTTTGGCGCCACCATCACCTCCTTGTCTGTCCCCGACAACAACGGGAAACTGGCTGATGT
GGTTCTCGGATTTGACTCTGTGGATCCATATGTGAACGGGCTTGCACCTTACTTTGGGTGCATAGTTGGTCGTGTAGCAA
ATCGGATCAAAGAAGGCAAGTTTAGTCTCAATGGAGTTGACTACACTTTGCCCATCAACAACGGTCCCAATAGCCTCCAC
GGTGGTAACAATGGTTTCGATAAGAAGACATGGGAAGTCGCAGGACACAAGAAAGACGGTGACAAACCTTTCATCACATT
CAAATATCACAGCGCCGATGGAGAAGAAGGTTATCCCGGTGCGGTTACTGTCACGGCCACATACACTCTCACGTCAGCCA
CGACCATGAGACTTGACATGGAGGCAGTTCCTGAGAACAAAGACACTCCAATCAGCTTAGCTCAGCATACATACTGGAAC
TTATCGGGTCACGACTCAGGAAACATTCTTGACCACAGGATCCAAATCTGGGGTTCTCATATCACCCCCGTGGATCAACA
CTCAGTTCCTACAGGTGAGCTCTTACCGGTAAAAGGAACTCCATTCGATTTCACCGAGGAGAAACGGATAGGAGATCGTA
TTGGAGAGGTGGGTATAGGATATGATCACAACTACGTGTTGGACTGTGCTGATCAAGAGAAAGACGGGCTGAAACACGCG
GCGAAGCTAAGAGACGGTGAGAGCTCAAGGGTGATGGACTTGTGGACCGATGCTCCGGGTGTGCAGTTTTATACGGGGAA
CTATGTGGATGGAGTGGTGGGGAAAGGGAATGCGGTTTATGGGAAGCATTCAGGTGTGTGCCTTGAGACGCAGGGGTTCC
CTAACGCGATTAACCAGAAGAGTTTCCCGTGTGTTGTGGTCAAGGCTGGTGAGAAGTATAAGCACACGATGTTGTTTGAG
TTTTCAGCTTGA