Details for Kale Locus Bo5g121390

Position : C5 ( 5`- 37064799 .. 37069775 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g121390

Protein [Map View]
MASHASNLWVLLGLGIAGILLAAKKLKKTIREDFGAFVDKLLLLPPPQPAPPKAPHPLTGLSFAISDVFDVTGYVTGFGH
PDWVKTHEAASSTCPVVSTLVEGGATCVGKTVVDELAFSISGENKHYESPTNPAAHDRIPGGACSGAAVAVATNAVDFAL
GIDTVGGVRVPAGYCGVLGFKSSHGAISNTGIIPVSSSLDSVGWFARDPNTLRRVGHVLLHLPFATQRNPRQIIVADDYF
QLLKIPVDRITQVVTKSAEKLFGRQSLKHQNLESYFESKVPSLKEFTRTKAIANTKAPTSRLLANVMQLLQRHEFLQNHG
DWINTVKPAIDPVISSQVCENAELTNEEIENLNAIRNQTRVAINSLLKDDSILVIPTMPTLPPKLGSKEIISEDYQNRAS
SLLSVASISGCCQVTVPLGRHEKCPVSVSFIGRHGGDRFLLDTVQTMYASLQENSSIVADPKSSKKTISQEESAEIAKEK
GNQAFKEKQWQKAIGLYSEAIKLSENNATYYSNRAAAYLEIGSFLLAEEDCTKAIALDKKNVKAYLRRGTAREMLGEYKE
AMDDFRHALVLEPNNKRASLSAERLRKAFYLDTLCESSPKMESKYYRCNGVLAFTKIGFPKLTFILNNGYRNSRSSSNQC
EVRIRIKRGVNLAVRDINSSDPYVVVKMGKQKLKTRVINKDVNPEWNEDLTLSVTDPTLTVLLTVYDHDMFSKDDKMGDA
EFEIKPYIEALKMHLDGLPSGTIVTTVQPCRRNCLAEESKVTWVDGKLVQDLVLRLRHVECGEVEAQLQWIDLPGSKGL*

DNA
ATGGCGTCTCACGCTTCGAATCTCTGGGTGCTTCTAGGTTTAGGCATCGCTGGGATTCTCCTGGCTGCTAAGAAGCTGAA
GAAGACCATCCGTGAAGATTTCGGCGCCTTCGTCGACAAGCTCCTTCTGCTTCCTCCGCCTCAGCCTGCTCCTCCCAAAG
CCCCTCATCCTCTCACCGGTCTCTCTTTCGCCATATCCGACGTATTCGATGTTACAGGCTACGTGACTGGCTTTGGTCAT
CCAGATTGGGTTAAGACGCATGAAGCTGCTTCGTCAACATGTCCTGTGGTTTCAACTCTCGTTGAAGGTGGAGCCACTTG
CGTTGGCAAAACTGTTGTTGATGAACTTGCCTTTAGTATCAGTGGAGAAAACAAGCATTACGAGTCTCCCACAAATCCTG
CTGCTCATGATCGTATTCCTGGTGGCGCTTGCAGTGGAGCTGCTGTTGCCGTGGCCACTAACGCTGTGGATTTTGCCTTA
GGCATCGACACAGTTGGCGGGGTAAGAGTGCCTGCTGGATACTGTGGCGTTCTTGGATTCAAATCTTCCCATGGGGCTAT
TTCAAACACGGGGATCATACCAGTATCTTCTAGTCTTGACTCTGTTGGATGGTTTGCACGCGATCCAAACACCCTACGTC
GTGTTGGCCATGTACTCTTACACCTTCCGTTTGCCACACAACGGAATCCAAGGCAAATCATAGTAGCTGATGACTATTTT
CAGCTCTTAAAGATCCCTGTGGACCGGATTACACAGGTGGTGACCAAATCAGCTGAAAAGCTCTTCGGAAGACAATCGCT
GAAGCATCAGAACCTGGAGAGCTATTTCGAATCTAAAGTTCCTAGCTTGAAAGAATTCACCAGGACAAAAGCCATTGCTA
ACACGAAGGCCCCAACTTCAAGACTACTAGCAAATGTGATGCAGCTTCTTCAAAGGCACGAGTTTCTTCAGAACCATGGA
GACTGGATCAATACAGTGAAGCCAGCTATTGATCCTGTGATTTCTTCACAAGTGTGTGAGAACGCAGAACTAACCAATGA
AGAGATTGAGAATCTGAATGCAATCAGAAACCAGACACGAGTAGCTATTAATTCACTTCTTAAGGATGATAGCATTCTGG
TTATCCCAACAATGCCAACTCTTCCTCCAAAACTTGGTAGCAAAGAGATCATCTCCGAAGACTATCAAAACCGAGCTTCC
AGTCTACTTAGCGTTGCTAGCATATCGGGCTGTTGTCAGGTGACTGTACCGCTGGGACGCCACGAGAAGTGCCCTGTTTC
AGTTTCTTTCATAGGAAGACACGGCGGCGACCGCTTTTTACTAGATACAGTGCAGACAATGTATGCGTCTTTGCAAGAGA
ACTCCAGCATTGTTGCCGATCCCAAATCATCTAAAAAGACTATCAGCCAAGAAGAGTCAGCTGAAATTGCCAAAGAGAAG
GGTAACCAAGCATTTAAAGAGAAACAATGGCAGAAAGCTATTGGCCTCTACTCAGAAGCTATTAAGCTGAGTGAAAACAA
TGCTACTTATTACAGTAACAGAGCCGCTGCATATCTTGAAATTGGAAGCTTTCTTCTAGCCGAAGAAGACTGTACCAAAG
CCATCGCTCTCGACAAGAAGAATGTGAAAGCCTATTTAAGAAGAGGAACCGCGAGGGAAATGTTAGGCGAGTACAAGGAA
GCCATGGATGATTTCAGACACGCACTGGTGTTGGAACCAAACAACAAGAGAGCGTCTCTATCTGCCGAGAGGCTGCGAAA
GGCATTTTATTTAGATACACTTTGCGAGTCTTCGCCGAAAATGGAATCTAAATATTACCGTTGTAACGGAGTTTTAGCGT
TCACCAAAATTGGATTCCCAAAACTAACGTTCATCCTAAACAACGGATACCGAAACTCCCGGTCTTCTTCAAATCAATGT
GAAGTTAGAATCCGCATCAAACGAGGCGTCAATCTCGCCGTCCGTGACATCAATAGCAGCGACCCTTACGTCGTTGTCAA
AATGGGCAAACAGAAATTGAAGACTCGTGTTATCAACAAAGACGTAAATCCAGAATGGAATGAAGATCTGACTCTCTCCG
TCACAGACCCCACTCTTACCGTCCTCTTGACGGTGTACGACCACGACATGTTTAGCAAGGACGACAAGATGGGCGATGCA
GAGTTCGAGATAAAGCCGTATATTGAGGCTTTAAAAATGCACCTTGACGGTCTTCCTAGTGGAACCATTGTCACCACGGT
TCAGCCATGTCGTCGCAACTGTCTAGCTGAGGAGTCTAAAGTCACTTGGGTCGACGGTAAGCTCGTTCAGGATCTCGTTC
TCAGATTACGTCACGTTGAATGTGGAGAGGTCGAGGCTCAGCTTCAGTGGATTGACCTCCCTGGCTCCAAGGGTCTATGA