Details for Kale Locus Bo5g121380

Position : C5 ( 5`- 37059487 .. 37062073 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g121380

Protein [Map View]
MAASYEAERDVQKNYWIEHSADLTVEAMMLDSRAADLDKEERPEVLSLLPPYEGKSVLELGAGIGRFTGELAQKAGELIA
LDFIDSVIKKNESVNGHYKNVKFMCADVTSPDLNITDGSIDLIFSNWLLMYLSDKEVELLVERMVGWIKVGGYIFFRESC
FHQSGDSKRKSNPTHYREPRFYTKVFQECVTRDAAGNSFELSMIGQKCIGAYVKNKKNQNQICWIWQKVSSENDRGFQRF
LDNVQYKSSGILRYERVFGQGFVSTGGIETTKEFVEKMDLKPGQKVLDVGCGIGGGDFYMAENFDVHVVGIDLSVNMISF
ALERAIGLNCSVEFEVADCTTKHYPENSFDVIYSRDTILHIQDKPALFRTFFKWLKPGGKVLISDYCKSSETPSPEFSEY
IKQRGYDLHDVQAYGQMLKDAGFNDVIAEDRTDQFMQVLRRELERVEKEKEEFISDFSKEDYEDIVGGWKAKLERSASGE
QKWGLFIANKN*

DNA
ATGGCAGCATCGTACGAAGCAGAGCGTGACGTCCAGAAGAATTACTGGATTGAGCATTCGGCTGATCTGACTGTTGAAGC
TATGATGCTCGACTCTCGTGCTGCTGATCTCGACAAGGAAGAACGCCCTGAGGTGCTCTCTTTGCTTCCACCCTACGAAG
GCAAGTCGGTGCTGGAGCTTGGAGCTGGTATTGGTCGTTTCACTGGTGAATTGGCTCAGAAGGCTGGTGAACTCATTGCT
CTTGACTTCATTGATAGCGTCATCAAGAAGAATGAGAGTGTTAATGGGCACTACAAGAATGTGAAGTTTATGTGTGCTGA
TGTTACCTCCCCTGACCTGAACATCACTGATGGATCCATCGACTTAATTTTCTCCAACTGGCTTCTCATGTATCTCTCTG
ACAAAGAGGTGGAGCTTTTGGTAGAAAGGATGGTTGGTTGGATCAAAGTTGGAGGATACATTTTCTTCCGAGAATCTTGC
TTCCACCAATCTGGTGACAGCAAGCGCAAGTCCAACCCCACTCACTACCGTGAACCCCGTTTCTATACCAAGGTATTTCA
AGAATGTGTGACACGAGATGCTGCTGGGAACTCATTTGAGCTCTCTATGATCGGGCAAAAGTGCATTGGAGCTTATGTGA
AGAACAAGAAGAATCAGAACCAGATTTGCTGGATTTGGCAGAAAGTCAGCTCAGAGAATGACAGAGGCTTCCAACGTTTC
TTGGACAACGTTCAATACAAATCCAGTGGGATCCTCCGCTATGAGCGTGTCTTTGGACAAGGCTTTGTGAGCACTGGTGG
AATCGAGACAACCAAAGAGTTTGTGGAGAAAATGGATCTGAAACCAGGACAGAAAGTGTTAGATGTTGGTTGTGGCATTG
GTGGAGGTGACTTCTACATGGCTGAGAACTTCGATGTTCATGTGGTTGGTATCGATCTGTCCGTCAACATGATTTCATTC
GCACTGGAACGTGCTATTGGACTCAACTGCTCGGTTGAGTTTGAGGTCGCGGATTGCACCACAAAACATTACCCTGAGAA
TTCCTTTGATGTCATTTACAGCCGTGACACTATTCTGCACATCCAAGACAAACCAGCTTTGTTCAGGACTTTCTTCAAGT
GGCTTAAACCGGGAGGCAAAGTGCTCATCAGCGACTACTGTAAGAGCTCGGAAACTCCATCTCCTGAGTTTTCTGAGTAC
ATCAAACAGAGAGGATATGATCTCCATGATGTTCAAGCTTATGGGCAGATGCTAAAAGACGCAGGCTTTAACGATGTGAT
CGCAGAAGACCGTACTGATCAGTTTATGCAAGTCCTGAGACGTGAACTAGAGAGGGTGGAGAAAGAAAAGGAAGAGTTCA
TCTCCGACTTCTCCAAAGAGGACTACGAGGACATAGTTGGTGGATGGAAGGCGAAGCTGGAGAGAAGTGCTTCGGGTGAG
CAGAAGTGGGGACTTTTCATCGCCAACAAGAACTAA