Details for Kale Locus Bo5g121370

Position : C5 ( 5`- 37040992 .. 37043171 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g121370

Protein [Map View]
MWMMGYNEGGADSFNGGRKLRPLIPRLSSCPSAAANTNSDHRFNMAVMTTMTAEQNKRELMMLNSEHQHPPMMVSSRWNP
TPDQLKALEELYQQGTRTPSADHIQQITAQLRRYGKIEGKNVFYWFQNHKARERQKRRRQMENGHDESVFTTTSLVSNHG
FDKKYPPGYKVEQTKNWICSVGCDTQPQKPHELHHQEEPVSIALATKGNGRYVGNERQSFPGRNAMSQMMQLAPGHYPSS
RQQQHHHELILNSTTVRSSFSTSNSTVSAAKDTVTASPSFLRTRAATNTGTCDDNKDQERHEDCLNGELDHQEKTLELFP
LRKEGFCNNGGDDGKEKESAIHCFYEFLPLKN*

DNA
ATGTGGATGATGGGTTACAACGAAGGAGGTGCAGATTCCTTCAACGGAGGAAGAAAACTTCGTCCTCTCATCCCACGCCT
CTCCTCTTGCCCCAGTGCCGCCGCAAACACCAACTCCGACCACCGCTTTAACATGGCAGTGATGACTACAATGACGGCTG
AGCAGAACAAAAGGGAGCTCATGATGCTAAACTCAGAGCATCAACATCCACCTATGATGGTGAGCTCACGGTGGAACCCG
ACACCGGATCAGTTAAAAGCTCTTGAAGAGCTTTACCAACAAGGAACTAGAACTCCTTCTGCCGACCATATCCAACAAAT
CACCGCGCAGCTACGTAGGTACGGAAAGATCGAAGGCAAAAATGTTTTCTATTGGTTCCAAAACCACAAAGCACGTGAAC
GCCAAAAACGGCGACGACAGATGGAAAATGGCCACGACGAATCTGTCTTTACGACAACCAGTCTTGTCTCAAATCACGGT
TTCGACAAGAAATATCCACCAGGTTACAAGGTTGAACAGACGAAGAACTGGATATGTTCGGTCGGATGCGACACACAACC
ACAGAAACCTCATGAACTTCATCATCAGGAGGAGCCTGTCTCCATAGCATTAGCAACAAAGGGCAATGGTCGTTATGTAG
GAAACGAGAGACAAAGCTTTCCCGGGAGAAATGCCATGTCGCAAATGATGCAGCTTGCACCTGGACATTACCCTTCTTCA
CGACAACAACAGCATCATCATGAACTCATTCTCAATTCCACTACTGTTAGGTCTAGCTTCTCCACTAGCAACAGTACTGT
TTCGGCTGCTAAAGATACCGTCACAGCTTCACCTTCATTTCTGAGGACAAGAGCAGCAACCAACACAGGAACTTGTGATG
ATAATAAAGATCAAGAACGTCATGAAGATTGCTTAAACGGTGAACTGGATCATCAAGAAAAGACACTAGAGCTGTTTCCA
CTGAGAAAAGAAGGGTTTTGTAACAATGGTGGAGATGATGGGAAAGAGAAAGAGAGCGCCATTCACTGTTTCTATGAGTT
TCTTCCATTGAAGAACTAA