Details for Kale Locus Bo5g121310

Position : C5 ( 5`- 36981674 .. 36982833 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g121310

Protein [Map View]
MRKERTDRTRTYNIYLRALCVVDNPIEILNVLVSMLQGDCRPDEYTPNTVIDGFFKMCKVDDAIKVLGDMVTGKFCAPDA
VTLRRAEEALDVLDWVMPENGLKPSVVTYNAVMRGLFKLPKGVEAMCVFDQMAKAGVCADNTTYAIIIDGLCATGQVDTA
KRFWDDVIWPSGRHDASGLRREAYQIIEEMRKNGHAPDAVTWRILDKLHDSRALAVEGE*

DNA
ATGAGAAAAGAAAGAACTGATAGAACTAGAACCTACAATATCTACCTACGAGCTCTCTGCGTAGTGGATAACCCGATAGA
GATCTTGAATGTTCTGGTCAGTATGCTTCAGGGAGACTGTAGGCCCGATGAGTATACACCTAACACAGTCATTGATGGAT
TTTTCAAGATGTGTAAAGTGGATGACGCCATTAAAGTTCTTGGCGATATGGTGACAGGGAAGTTCTGCGCGCCTGATGCT
GTGACTCTAAGAAGAGCAGAAGAAGCTCTTGATGTGTTGGATTGGGTTATGCCTGAGAACGGGTTGAAGCCAAGTGTTGT
TACATACAACGCTGTTATGCGTGGATTGTTCAAGCTCCCTAAGGGAGTTGAAGCTATGTGCGTGTTTGATCAGATGGCAA
AGGCAGGTGTGTGCGCAGATAATACTACATATGCTATCATCATTGACGGGTTGTGTGCGACTGGTCAGGTGGATACGGCG
AAGAGGTTCTGGGACGATGTGATATGGCCATCAGGCAGACATGATGCAAGTGGGTTGAGGAGAGAGGCGTACCAGATTAT
AGAGGAGATGAGAAAGAACGGTCACGCTCCTGATGCTGTCACATGGCGGATACTAGATAAACTACATGATTCCAGAGCTT
TAGCAGTGGAAGGAGAGTAA