Details for Kale Locus Bo5g121300

Position : C5 ( 5`- 36980651 .. 36981330 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g121300

Protein [Map View]
MESGKRDRDMEVQTTHRKPRVLLAASGSVAAIKFGNLCHCFREWAEVRAVVSKSSLPFLDRLSLPREGAGTRSIAGGLCD
NLLTCIIRAWDYSKPLFVAPAMNTLMWNSPFTERHLLTLDELGVTLIPPIKKRLACGDYGNGAMAEPSLIYSTVRLFWES
QAHQQSAGTS*

DNA
ATGGAGAGTGGGAAACGAGACAGAGACATGGAAGTGCAAACCACTCACAGGAAGCCACGTGTACTGCTCGCTGCAAGCGG
AAGCGTCGCGGCTATCAAATTCGGCAACCTCTGCCATTGCTTCAGAGAGTGGGCTGAAGTGAGAGCCGTCGTATCGAAAT
CGTCTCTGCCTTTCCTCGACAGACTCTCTCTCCCACGGGAGGGAGCTGGAACAAGATCGATTGCTGGTGGGCTGTGTGAT
AATCTTCTGACTTGTATCATTCGAGCTTGGGATTACAGCAAACCCCTTTTCGTTGCACCAGCGATGAATACTTTAATGTG
GAACAGTCCTTTTACAGAAAGGCATCTGTTGACGCTTGATGAACTTGGAGTCACACTCATTCCTCCCATCAAGAAGAGAT
TGGCGTGTGGGGACTATGGTAACGGCGCAATGGCTGAGCCTTCTCTTATCTATTCCACTGTCAGACTCTTCTGGGAGTCC
CAGGCTCATCAGCAAAGTGCTGGAACAAGTTAA