Details for Kale Locus Bo5g121270

Position : C5 ( 5`- 36838972 .. 36840865 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g121270

Protein [Map View]
MFHHAPSFISLIIFFTILSAASPNKDPVTVQPFLVKSSPPATIPAFPEQSDFSGCPLDLPDDLFHGIKSACTGKKLHKGK
CCPVLGAWLYSAYSTTALSRSIPSSAVRNATSAATTPEEDMPLLPDDSETCVDGLEKSLRRRGIELASPNETCGVVDCYC
GIRLHHLSCSEAFSVNGEGRLVGDESVDRLETDCLSVRNNNGDRFSPLSRCNKCLKSLYKLNPKKTSGTRNPSKEDRNRT
TKMHNKDCVLMGLTWLLAKNRTAYFPTVTSVLRAVMLSQNGEPRSCALGGDGMPLAVDSSEFSNGSSTLIQYPYHLVHFL
LYSVITLVLLGSW*

DNA
ATGTTCCATCACGCGCCGTCTTTCATTTCCCTCATCATCTTCTTCACCATTCTGTCAGCCGCATCACCAAACAAAGACCC
GGTCACCGTCCAGCCATTCCTGGTCAAGTCATCCCCACCCGCCACCATACCCGCTTTCCCGGAGCAGTCCGACTTCTCCG
GCTGCCCACTCGATCTACCAGACGACCTCTTCCACGGAATCAAGTCAGCCTGCACCGGCAAAAAGCTCCACAAAGGAAAA
TGCTGCCCCGTGCTAGGCGCGTGGCTCTACTCCGCTTACTCGACCACTGCTCTCAGCCGTTCCATTCCCAGCTCCGCCGT
TAGAAACGCGACCTCCGCCGCGACCACGCCGGAAGAGGATATGCCTTTGCTTCCAGACGACTCGGAGACTTGCGTCGATG
GTTTGGAGAAATCTTTGAGGAGGAGAGGGATCGAGCTGGCGAGTCCGAATGAGACGTGCGGCGTGGTTGACTGCTACTGC
GGGATAAGGTTGCATCACTTGAGCTGTTCCGAGGCGTTTAGTGTGAATGGAGAAGGGAGGCTCGTTGGAGACGAGAGTGT
TGATCGGTTAGAGACTGATTGTTTGAGTGTAAGAAACAACAATGGCGATAGATTCTCTCCGCTCAGTAGATGTAACAAGT
GCTTGAAGAGCCTCTATAAGCTTAACCCGAAGAAAACATCAGGGACAAGAAACCCATCGAAGGAAGACAGAAACAGAACA
ACAAAGATGCACAACAAAGACTGTGTTCTAATGGGTCTCACTTGGCTTCTCGCTAAGAACCGTACGGCTTACTTCCCCAC
TGTCACTTCAGTCCTCCGAGCCGTCATGCTCAGCCAAAACGGTGAGCCACGGTCATGTGCTCTCGGCGGTGACGGCATGC
CTTTAGCTGTTGACTCTTCCGAATTCTCTAACGGCTCATCAACTTTAATTCAGTACCCGTACCACTTGGTCCACTTCTTA
CTTTACAGCGTCATCACATTGGTCTTGCTAGGGTCGTGGTGA