Details for Kale Locus Bo5g121250

Position : C5 ( 5`- 36808828 .. 36811210 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g121250

Protein [Map View]
LAGRIDDLQWSADGMRIVASGDGKGKSLVRAFMWDSGSNVGEFDGHSRRVLSCAFKPTRPFRIVTCGEDFLVNFYEGPPF
KFKLSSREHSNFVNCVRYSPDGSKFITVSSDKKGVIYDGKTCEKLGELSSEDVHKGSIYAVSWSPDGKEVLTVSADKSAK
VWEISDSGNGTLKTTLTCPGSSGGVDDMLVGCLWQNDHIVTVSLGGTISIFSASDLDKSPFQFSGHMKNISSLSVLRGSS
DYILSGSYDGLICKWMMGRGFCGKLQRKQNSQIKCFAAHEEEIITSGFDNTISRISYQDGQCTNEESIGVGNQPNDLSLA
PLSPGLLLVAFESGVVFLRGEKVVSTINLGFTVTALAVTPDGTEAIVGGQDGKLRLYAVNGDSLTEEAVLEKHRGAISVI
RYSPDLSMFASADLNREAVVWDRASREMKLKNMLYHSARINCLAWSPNSSMVATGSLDTCVIVYEVDKPASTRMTIKGAH
LGGVYGLGFADDTHVVSSGEDACIRVWSLTPQ*

DNA
TTGGCTGGGAGGATCGATGATCTCCAGTGGTCGGCTGATGGGATGCGGATCGTTGCTTCTGGTGATGGCAAAGGAAAGTC
TCTAGTTCGTGCTTTCATGTGGGATTCAGGATCGAATGTGGGAGAGTTTGATGGACATTCAAGGCGTGTTCTTAGCTGTG
CTTTCAAGCCTACCAGACCCTTCCGCATTGTAACTTGTGGAGAGGATTTTCTGGTTAATTTCTACGAAGGTCCTCCTTTC
AAGTTCAAGCTCTCAAGCAGAGAACATTCCAACTTTGTCAACTGTGTGAGGTATTCACCAGATGGAAGCAAGTTCATTAC
TGTAAGTTCAGACAAAAAGGGAGTCATATATGATGGAAAGACTTGTGAGAAACTGGGAGAACTCTCATCTGAAGATGTGC
ATAAAGGTAGCATCTACGCTGTTAGCTGGAGTCCTGATGGCAAAGAGGTCCTCACTGTATCTGCGGACAAGTCAGCTAAA
GTATGGGAAATCTCGGATTCTGGTAACGGAACATTGAAGACCACGTTGACTTGTCCAGGATCATCAGGTGGAGTGGACGA
TATGCTTGTCGGGTGTCTGTGGCAGAACGATCATATCGTCACTGTTTCTCTTGGTGGTACAATCAGCATATTCTCAGCAA
GCGATCTTGATAAATCCCCCTTCCAGTTTTCGGGACACATGAAGAACATCTCTTCCTTATCTGTGCTCAGAGGAAGTTCT
GACTACATACTATCCGGTAGCTACGATGGTCTGATATGTAAATGGATGATGGGCCGTGGTTTTTGCGGTAAATTGCAGCG
GAAGCAAAACTCTCAGATAAAGTGCTTTGCTGCTCATGAAGAAGAGATAATCACATCTGGATTTGACAATACGATATCCA
GGATCTCTTATCAAGACGGCCAGTGCACAAACGAAGAGTCTATTGGCGTTGGAAACCAGCCAAATGATCTAAGCCTTGCA
CCGCTCTCACCAGGTCTCCTTCTGGTGGCCTTTGAGTCAGGAGTTGTGTTTCTCCGTGGTGAGAAAGTAGTGTCAACCAT
CAACCTTGGGTTCACTGTCACTGCTTTGGCTGTAACACCTGATGGAACTGAAGCTATTGTCGGTGGTCAAGACGGTAAGC
TCCGTCTGTATGCTGTTAATGGTGATTCCCTCACCGAGGAAGCAGTTCTTGAGAAACACAGAGGCGCCATCAGCGTCATT
CGTTACTCCCCGGATTTATCTATGTTTGCATCAGCTGATTTGAACAGAGAAGCAGTTGTATGGGACAGAGCCTCCAGAGA
GATGAAGCTGAAGAATATGTTGTACCATAGCGCCCGCATAAACTGCCTAGCTTGGTCTCCAAACAGCAGTATGGTTGCTA
CGGGATCCTTAGACACATGTGTGATTGTGTATGAAGTGGACAAACCTGCTTCCACACGGATGACCATTAAAGGAGCTCAC
TTAGGTGGAGTTTATGGTCTGGGTTTCGCTGATGATACCCATGTTGTGAGTTCTGGTGAAGATGCTTGTATCCGGGTTTG
GAGCTTAACTCCTCAATAA