Details for Kale Locus Bo5g121240

Position : C5 ( 5`- 36805205 .. 36807790 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g121240

Protein [Map View]
MTDIDIEEIEAAGEVDLRDLGEPFLQSFCKKAATSFFDEYGLVSHQLNSYNFFIEHGLQSVFESSGEMLVEPSFDPTKNK
DHEWRYATVKFGEVSVDKPTLYSDDKELVFLPWHARLQNMTYSARMKVNVDVEVFVKKVVKRDKFKTGQDEYVEKQILSK
KTQDIPIGRIPVMVKSVLCNTTEKGKNGESYRKGECAFDQGGYFVIKGAEKVFIAQEQICTKRLWISNSPWTVSYRSETK
RNRFIVRLSENQKAEDFKRKEKVLTVYFLSTEIPVWVLFFALGVASDKEAVDLIAFDGGDASITNSVVASIQEADSVCED
FRHGRNALAYVEQQIKGTKFPPGESVDECLSLYLFPGLKSLKQKARFLGYMVKCLFSAYAGKRKCENRDNFRNKRIELAG
ELLERELRVHLAHARRTMTKAMQRHLTGDGDLKPISLLCTESGTDHSVKLKHTERGIVQKVVLSSNDDGKNYATVSLRQV
RSPCLGDKFSSMHGQKGVLGYIEEQENFAFTNQGIVPDIVINPHAFPSRQTPGQLLEAALSKGIACPMQKKKGKSDAYSK
VTRHATPFSTPSVDDITDQLHRALC*

DNA
ATGACTGATATCGACATTGAAGAGATTGAGGCCGCTGGGGAAGTCGATTTGCGCGACCTAGGAGAGCCGTTTCTCCAGAG
CTTCTGCAAGAAAGCTGCGACGTCCTTCTTCGACGAGTACGGCCTCGTCAGCCACCAGCTCAACTCCTACAACTTCTTCA
TCGAGCACGGCCTTCAGAGCGTGTTTGAGTCCTCCGGTGAGATGCTCGTTGAGCCGTCCTTTGACCCTACGAAGAACAAG
GACCATGAGTGGAGATACGCCACGGTGAAGTTCGGAGAAGTCAGCGTGGATAAGCCTACCTTGTACTCTGATGATAAGGA
GCTTGTGTTTCTCCCGTGGCACGCTAGGCTTCAGAACATGACTTACTCTGCGAGGATGAAAGTTAATGTCGATGTTGAGG
TGTTCGTTAAGAAAGTCGTTAAAAGAGACAAGTTCAAGACGGGACAAGACGAATACGTTGAAAAGCAGATCTTGTCTAAG
AAGACGCAGGACATCCCAATTGGTAGGATACCCGTGATGGTGAAATCCGTTCTTTGCAACACAACGGAGAAGGGAAAGAA
TGGGGAAAGCTACAGAAAGGGGGAGTGTGCATTTGACCAGGGTGGATACTTTGTGATTAAAGGAGCTGAGAAGGTCTTTA
TTGCTCAAGAGCAGATATGCACAAAGAGACTTTGGATTTCTAATTCACCATGGACCGTCTCCTACAGGTCCGAAACCAAA
AGAAATCGTTTCATTGTGCGTCTATCAGAGAATCAGAAAGCTGAAGACTTTAAGAGAAAGGAGAAAGTACTGACAGTGTA
CTTCCTGTCAACTGAGATCCCAGTCTGGGTCCTGTTCTTTGCGCTGGGGGTTGCGTCAGACAAAGAGGCTGTAGATCTAA
TTGCTTTCGATGGTGGTGATGCAAGTATTACCAACAGCGTCGTAGCTTCGATCCAGGAAGCTGATTCGGTTTGCGAAGAT
TTTCGCCATGGGAGGAATGCTCTGGCATATGTTGAACAGCAGATAAAAGGCACAAAATTCCCACCTGGTGAGAGTGTGGA
TGAATGCCTAAGTCTGTACCTGTTTCCAGGCCTCAAGAGTTTGAAGCAGAAAGCACGATTCTTGGGCTACATGGTGAAAT
GCCTTTTTAGCGCATATGCTGGGAAAAGAAAGTGTGAGAACAGAGACAACTTTAGGAACAAGAGGATCGAACTAGCTGGA
GAGCTGCTGGAAAGGGAACTAAGGGTGCATTTGGCGCATGCTAGAAGGACAATGACCAAAGCCATGCAGAGACACCTCAC
GGGCGATGGTGATCTGAAGCCTATTTCCCTTTTATGCACCGAGTCTGGGACTGATCACAGCGTGAAACTGAAGCACACTG
AGAGAGGGATAGTGCAGAAGGTGGTTCTATCATCCAATGACGATGGGAAGAATTATGCCACTGTTTCTCTGAGACAGGTT
CGTTCTCCATGTCTTGGAGATAAATTTTCCAGTATGCATGGCCAGAAGGGTGTTTTAGGCTATATAGAGGAGCAGGAGAA
TTTTGCTTTCACGAATCAAGGCATAGTTCCTGATATCGTGATCAATCCGCATGCATTCCCTTCTCGGCAAACACCGGGCC
AACTCTTGGAGGCTGCTCTGTCCAAAGGAATAGCTTGTCCTATGCAAAAGAAGAAGGGCAAGTCTGATGCATACTCCAAA
GTGACACGCCATGCCACTCCTTTCTCCACTCCCAGTGTCGATGACATAACCGACCAGCTTCACAGGGCTTTGTGCTAA