Details for Kale Locus Bo5g121220

Position : C5 ( 5`- 36800314 .. 36802324 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g121220

Protein [Map View]
MLRSLKSQLAPSTTGPPVGLPLPSDSESDDDFELLRSLKSQLALSMNASLPPMSLSDDDSFETLRAIRRRFSAYANLDQD
GAFMNDSLGKKKQGGKVVTLPDSEGTQAGDSVDLHENNATAPLDQSSSFPEAAQAFVEAIRRNRAYQKFLRKKLTEIEAK
IVQNEKHQKNVKIVVDFQASCKRITKQALSQGRDPRLQLISTPKCGPRDSSEDNDKKISPLTFGPPENSCVENYRMAVKN
YPVSVNRRSWSTEENENLAKGLKQQLQETLLNEAIERSSDLEGSTDDIDAINESIKNLEITPEMIRQFLPKVNWDQLASM
WMSSEDPLINHGPWTAEEENNLRLIIQEKGFTDWLDIA*

DNA
ATGCTTCGGAGCCTCAAGAGCCAATTAGCTCCGTCGACGACGGGTCCTCCCGTGGGTTTACCACTGCCTTCAGATTCGGA
GAGTGACGACGACTTCGAGTTGCTTCGGAGCCTCAAGAGCCAGCTGGCATTGTCCATGAATGCGTCCCTTCCTCCCATGA
GTCTCTCCGATGATGATTCTTTTGAAACGCTTCGTGCCATTCGTAGGCGGTTCTCTGCTTATGCAAATCTTGATCAAGAT
GGAGCTTTTATGAATGATTCTCTCGGGAAGAAAAAGCAGGGGGGAAAAGTTGTCACATTGCCTGATTCAGAAGGAACACA
AGCGGGTGATTCTGTTGATTTACATGAGAACAATGCCACTGCACCTCTTGACCAATCTTCAAGTTTCCCTGAAGCTGCAC
AAGCCTTTGTTGAGGCAATCCGGAGGAACAGGGCGTATCAGAAGTTTCTTAGAAAGAAGCTGACTGAAATTGAAGCCAAG
ATCGTGCAGAACGAGAAGCACCAGAAGAACGTTAAGATAGTAGTAGACTTTCAAGCCTCTTGCAAGAGAATAACTAAACA
GGCGCTTTCTCAGGGGAGAGATCCTCGTCTCCAGTTAATCTCAACACCAAAATGTGGACCTCGTGATAGCTCAGAGGATA
ATGATAAAAAGATATCTCCTTTGACGTTTGGTCCACCGGAAAATAGCTGTGTTGAAAATTATAGGATGGCAGTAAAGAAC
TATCCAGTTTCAGTGAATCGCAGAAGTTGGTCTACTGAGGAGAATGAAAATCTTGCAAAAGGTCTAAAACAACAACTTCA
GGAAACACTGCTTAATGAAGCTATAGAACGTTCCAGTGACTTGGAAGGTTCTACAGATGATATAGACGCCATTAATGAAT
CGATCAAAAATCTTGAGATCACACCAGAGATGATTCGGCAGTTTCTTCCGAAAGTTAATTGGGATCAGTTGGCCTCAATG
TGGATGAGCTCGGAAGATCCATTAATCAACCACGGTCCGTGGACTGCGGAGGAAGAAAATAACCTGCGCCTGATTATCCA
AGAAAAGGGGTTTACAGACTGGCTTGACATTGCGTAG