Details for Kale Locus Bo5g121210

Position : C5 ( 5`- 36795161 .. 36798782 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g121210

Protein [Map View]
MMRLVAIICRRGVFFFLFVGLFLLVLALAPTFTVFGRFWFWWFDFGATVAGGGEPCLVEVSAFFGVMTPHIMPDNLAYSV
MLDVLLSGNETRTAWAVYHDMISDGHTPTHSLYELMILGLVKENRAEDIQKPIRDMEELCGMNPLEISSVLVKGECFDLA
ARQLKVAITNGYELQNDTLLSILRAYSSSGRHSEACELLEFLKEHASGSRLLINEALIVLHCKVNNIIAALEEYFAGACV
HGWSFGSSTMYESLLHCCVANERYAEASQVFSDLRLSGCEASESVCKSMVGVYCKLGFPETAHQVVTQAETKGFHFACST
TFTDIIEAYGKLKLWQKAESVVGNLRQNGRTPDLKTWNTLMTAYAECGCYERARAIFNTMMRDGPSPSVESINTLLHALC
VDGRLEELYVVVEELQDMGFKISKSSILLMLDAFAGARNIFEVKKICNSMKAAGYLPTIRLYRMMIEVLCKGKRVRDAEV
MVSEMEEAGFKVELAIWNSMLKMYTAIEDCKKTVQVYHRIKETGLEPDETTYNTLIIMYCRDRRPEEGYLLMQQMRNIGL
EPKLDTYKSLISAFGKQKCLEQAEQLFEELLSKGYKLDRSFFHTMMKISRDSGSDSKAANDEECGNTTNACYNASADVID
AYLPSKDYDSGIERLLEMKREGLEPDHRIWTCFVRAASFSKEKSEVMFLLKALQDIDGRPELLVSEVDEWFEKLRPIEDN
AALNFANALLNLLWAFELRVTATWVFQLAIKRVSAMANDASSVPRHVNRTLAEDASLEGYPESPKSVVLITGTAEYNGIS
LDKTLKACLWEMGSPFLPCKTRTGLLVAKAHSLRMWLKDSPFCFHLELKDSVSLPESSSMELIDGCFIRRGLVTAFNHIK
DRLGGFVSPKKFSRLALLPDEMRERVIKTDIEGHRQKLEKMRKKNKGNEMVSVNTRRKFIRSK*

DNA
ATGATGCGATTGGTCGCCATCATCTGTCGGAGGGGAGTCTTCTTCTTTCTTTTCGTTGGACTTTTTCTTCTTGTCCTTGC
TCTTGCTCCAACTTTTACTGTTTTTGGTCGTTTTTGGTTTTGGTGGTTCGACTTCGGTGCGACCGTCGCTGGTGGAGGCG
AGCCATGCCTCGTAGAGGTGTCTGCATTCTTTGGTGTCATGACCCCTCATATCATGCCTGATAATTTGGCGTATTCTGTA
ATGTTGGATGTGTTACTAAGCGGTAACGAGACAAGAACGGCGTGGGCTGTATATCATGATATGATTTCTGATGGTCATAC
ACCGACTCACAGTCTGTATGAGCTGATGATACTTGGACTTGTGAAGGAAAACAGGGCAGAGGACATTCAGAAGCCCATCA
GAGATATGGAAGAACTGTGTGGCATGAACCCACTCGAGATTTCCTCTGTTCTTGTTAAGGGCGAATGCTTTGATCTTGCC
GCTAGACAGTTGAAAGTAGCTATCACCAATGGCTATGAACTTCAAAACGACACGCTGTTATCTATCCTGCGTGCCTACAG
TTCATCAGGCAGGCATTCAGAAGCATGCGAGTTACTTGAGTTTTTGAAAGAACATGCCAGTGGATCTAGGCTGCTTATAA
ATGAAGCGCTAATTGTTCTACATTGCAAGGTTAACAATATAATTGCTGCGCTAGAAGAATACTTTGCTGGCGCATGTGTT
CATGGATGGAGTTTTGGCAGTTCCACCATGTATGAGTCTTTATTACACTGCTGTGTAGCAAATGAACGTTACGCAGAAGC
TTCTCAAGTTTTCTCTGACCTGAGACTGTCTGGCTGTGAAGCTTCAGAAAGTGTTTGTAAAAGCATGGTTGGTGTGTATT
GCAAGCTTGGCTTTCCAGAGACAGCTCATCAAGTGGTTACTCAGGCTGAGACAAAAGGCTTCCACTTTGCTTGTTCGACT
ACGTTTACTGATATCATTGAGGCTTATGGAAAACTAAAGCTATGGCAAAAAGCAGAGAGTGTGGTTGGCAACTTAAGACA
AAATGGACGAACCCCTGATCTCAAGACATGGAACACTTTGATGACGGCTTATGCTGAGTGTGGCTGTTACGAGCGGGCAA
GGGCTATATTTAACACTATGATGAGGGATGGTCCGTCTCCAAGTGTTGAATCCATCAACACTCTGTTGCATGCTTTGTGT
GTAGATGGAAGGCTTGAGGAGCTATACGTTGTCGTTGAAGAGTTGCAAGATATGGGCTTTAAGATTAGCAAAAGCTCCAT
TCTTTTGATGCTTGACGCATTTGCTGGAGCTAGAAATATCTTTGAGGTAAAGAAGATATGTAATAGCATGAAGGCTGCTG
GTTACTTGCCAACAATTCGCCTTTATAGGATGATGATTGAGGTTTTGTGCAAAGGGAAACGAGTCAGAGATGCGGAAGTT
ATGGTTTCTGAAATGGAAGAAGCTGGCTTCAAGGTCGAGCTCGCTATATGGAACTCCATGCTGAAGATGTATACAGCTAT
CGAGGATTGCAAGAAGACAGTTCAAGTGTACCATAGGATAAAAGAAACTGGGCTAGAACCAGATGAGACCACTTACAATA
CTCTCATTATAATGTATTGTAGAGACAGACGGCCAGAAGAAGGGTATTTGCTTATGCAGCAAATGAGAAATATTGGTCTG
GAACCAAAACTGGACACATACAAGAGTTTGATCTCAGCTTTTGGTAAGCAAAAATGCCTTGAGCAAGCTGAACAACTGTT
TGAAGAGCTTCTCTCCAAAGGCTATAAACTAGACCGTTCATTTTTCCACACGATGATGAAAATATCCCGAGATTCTGGGA
GCGATTCCAAGGCTGCAAATGATGAAGAGTGCGGGAATACAACCAACGCTTGCTACAATGCATCTGCTGATGTCATAGAT
GCTTACCTTCCGAGCAAAGATTATGACAGTGGAATAGAACGGCTATTGGAAATGAAGAGAGAGGGCCTCGAGCCAGACCA
CAGGATATGGACTTGCTTTGTTAGGGCGGCGAGTTTCTCCAAGGAAAAAAGTGAAGTTATGTTTCTGCTGAAAGCTCTTC
AAGATATTGATGGAAGACCTGAGTTGCTAGTTTCTGAGGTGGATGAATGGTTCGAGAAACTGAGACCCATAGAGGACAAT
GCTGCTCTCAATTTTGCCAATGCTCTTTTGAATCTTCTCTGGGCTTTCGAACTCAGAGTTACTGCAACATGGGTATTCCA
GTTGGCAATCAAAAGGGTTTCGGCCATGGCTAACGACGCTTCTTCTGTACCGAGGCATGTTAACAGAACTTTGGCAGAGG
ATGCATCACTTGAAGGGTACCCAGAATCTCCAAAGTCAGTAGTCTTAATCACAGGGACCGCAGAGTACAACGGCATCTCC
CTTGACAAAACTCTAAAAGCATGTCTTTGGGAGATGGGCTCTCCGTTTCTTCCCTGCAAGACGAGAACAGGACTTCTAGT
GGCGAAAGCTCACTCTCTCAGAATGTGGTTGAAGGACTCTCCTTTCTGCTTCCACTTGGAACTGAAAGACTCAGTTTCTT
TACCGGAATCAAGCTCGATGGAGCTGATCGACGGGTGTTTTATAAGACGCGGCCTTGTTACTGCATTTAACCACATCAAA
GACAGACTTGGTGGGTTTGTATCACCAAAGAAGTTTTCTAGACTAGCTCTACTACCGGATGAGATGAGAGAACGAGTGAT
TAAGACAGATATAGAAGGACATAGACAGAAGCTAGAGAAGATGAGGAAGAAGAATAAAGGAAATGAAATGGTAAGCGTTA
ACACTCGAAGGAAGTTCATTAGAAGTAAGTAA