Details for Kale Locus Bo5g120100

Position : C5 ( 5`- 36649090 .. 36650842 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g120100

Protein [Map View]
MATNNGDVLMLEAAPEATKPWASAANAEVIDALPYIDDDYGNPLIKAEVDRLVEEEMRRSSKKPADFLKDLPPLPKFDFE
NCPVLGKEYERVRAGKPPVRIDFESRYKHELPPAGKKNDDAAWKQYLHKTQRSLQQKKIELENLEMMSKQGPEIWRQNNH
RLEVFLTRMQRLAQEQNEEIEKVNRERKYHQQTTAYELNALSQEWRQLCVKNMEIQSACAVLETQIDSLKREASERGWNL
EEKLESVKPLQSQ*

DNA
ATGGCGACGAACAATGGAGACGTTTTGATGCTGGAGGCGGCGCCGGAGGCTACGAAACCCTGGGCGAGCGCGGCGAACGC
AGAAGTTATCGATGCGCTTCCTTATATAGACGATGACTACGGCAATCCACTGATTAAGGCTGAGGTGGACCGCTTGGTGG
AGGAAGAGATGCGTCGGAGCTCTAAGAAGCCTGCTGACTTCCTCAAGGATCTCCCTCCTCTTCCCAAGTTCGATTTCGAG
AACTGTCCAGTTCTAGGCAAAGAGTATGAGCGTGTTCGAGCCGGGAAGCCTCCAGTGCGGATTGATTTCGAGTCCCGGTA
TAAGCATGAATTGCCGCCTGCTGGTAAGAAAAATGATGATGCTGCCTGGAAGCAGTATCTTCACAAGACTCAACGTTCAT
TGCAACAGAAGAAGATCGAGCTTGAGAATTTGGAAATGATGTCAAAACAAGGGCCCGAGATTTGGAGACAGAACAACCAT
CGGCTAGAAGTATTCTTGACCAGAATGCAAAGACTAGCTCAGGAGCAGAACGAGGAGATTGAAAAAGTTAATCGCGAGAG
GAAGTATCATCAGCAAACCACAGCGTACGAGCTAAACGCTTTATCTCAAGAATGGAGACAGCTCTGTGTCAAGAACATGG
AGATTCAGTCTGCGTGTGCTGTGCTTGAGACACAAATCGATTCGTTGAAAAGGGAAGCTTCTGAAAGGGGATGGAACTTA
GAAGAGAAACTTGAAAGTGTCAAACCGCTTCAATCGCAGTGA