Details for Kale Locus Bo5g120070

Position : C5 ( 5`- 36629435 .. 36631931 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g120070

Protein [Map View]
MKEKDLLYHTILARSFSKNEQKRLGYGAFIASLFFVFTLCTIFKSYLNPLPTMETQLSVDTGLRILRVTETHKSQAFNSN
YTTTSGASESLIIPTTQNNITSNATNTQSLTSSEDDKLSVCNDTSLPKNYLDLFNCTTPTSISNEQSVSDGNKMEETVKC
KKQSRTEICELNGDVRVHGKSATILAAITSAFSGNSTWQMRPYARKGDLVAMSRVREWTVKLTQNADHLENANFSSRCVR
NHSVPAIVFSLGGYTMNNFHDFTDVVVPLFTTARRFNGEVRFLVTNKNQPWINKFKEILRSLSNYELIYIDGEDETHCFT
TVVVGLNRHPEYFKELTIDPSHSEYSMSDFRRFLRDTYSLRNAAVSTGESLRRRPRILIISRARSRAFTNTDEIANAAGE
IGFEVVVAEANTGVASFAETAMSRVREWTVKLTQNADHLENANFSSRCVRNHSVPAIVFSLGGYTMNNFHDFTDVVVPLF
TTARRFNGEVRFLVTNKNQPWINKFKEILRSLSNYELIYIDGEDETHCFTTVVVGLNRHPEYFKELTIDPSHSEYSMSDF
RRFLRDTYSLRNAAVSTGESLRRRPRILIISRARSRAFTNTDEIANAAGEIGFEVVVAEANTGVASFAETVNSCDVMLGV
HGAGLTNMVFLPENAVVFQILPIGGFEWLAETDFGRPAKGMNLTYLEYKIEAEESSLVRQYGRDHEVVRDPSAVAKRGWT
AFKSAYLVGQNVTVDINRFKPVLAKAFELLQRQSV*

DNA
ATGAAAGAGAAGGATCTTCTTTACCATACAATACTTGCTCGTAGCTTTAGCAAAAACGAGCAGAAGAGACTTGGCTATGG
AGCTTTCATTGCCTCTCTTTTCTTCGTCTTCACTCTTTGCACCATCTTTAAATCTTATCTCAACCCATTACCAACCATGG
AAACGCAATTATCAGTGGACACTGGTCTAAGGATACTGAGAGTAACAGAAACGCATAAATCGCAAGCGTTTAACAGCAAC
TATACAACAACATCTGGAGCTTCTGAGTCTCTCATTATCCCGACGACTCAAAATAACATTACATCAAACGCTACAAATAC
GCAGAGCTTAACCAGTTCTGAAGATGACAAGCTAAGTGTTTGCAACGACACAAGCTTGCCCAAGAATTATCTTGATTTGT
TTAACTGTACTACACCCACTTCAATCTCCAATGAACAATCTGTTTCAGACGGTAATAAAATGGAGGAAACGGTAAAATGT
AAGAAGCAATCAAGAACAGAGATATGCGAGTTAAACGGCGACGTAAGGGTCCACGGTAAATCCGCGACGATTCTTGCGGC
GATCACATCTGCGTTTTCGGGAAATTCCACGTGGCAAATGAGACCTTACGCGCGAAAAGGTGACCTTGTGGCCATGAGTC
GCGTTAGAGAATGGACGGTGAAATTAACACAAAACGCTGACCATTTAGAGAACGCTAATTTCTCATCGCGATGCGTTAGG
AATCACAGCGTTCCGGCGATTGTTTTCTCTCTCGGAGGCTACACGATGAACAACTTCCACGATTTCACCGACGTCGTGGT
CCCTCTTTTCACGACGGCGCGTAGATTCAACGGAGAAGTCCGGTTCCTCGTGACGAACAAGAATCAACCGTGGATCAACA
AATTTAAGGAGATACTGAGGAGTCTCTCGAACTACGAACTGATTTACATCGACGGAGAAGATGAAACGCACTGTTTCACC
ACCGTCGTCGTCGGTCTCAATCGCCATCCAGAGTACTTCAAAGAGCTGACGATCGATCCTTCCCATTCCGAGTATTCCAT
GTCCGATTTCCGGAGGTTCCTAAGAGACACTTACTCGCTGAGAAACGCCGCCGTGAGTACCGGAGAAAGTCTGCGGCGGA
GGCCACGGATCCTGATTATATCCAGAGCCAGATCGCGAGCCTTCACGAACACCGACGAGATCGCGAACGCGGCGGGAGAA
ATCGGATTCGAAGTCGTGGTGGCGGAAGCGAACACAGGCGTCGCGAGTTTCGCGGAGACGGCCATGAGTCGCGTTAGAGA
ATGGACGGTGAAATTAACACAAAACGCTGACCATTTAGAGAACGCTAATTTCTCATCGCGATGCGTTAGGAATCACAGCG
TTCCGGCGATTGTTTTCTCTCTCGGAGGCTACACGATGAACAACTTCCACGATTTCACCGACGTCGTGGTCCCTCTTTTC
ACGACGGCGCGTAGATTCAACGGAGAAGTCCGGTTCCTCGTGACGAACAAGAATCAACCGTGGATCAACAAATTTAAGGA
GATACTGAGGAGTCTCTCGAACTACGAACTGATTTACATCGACGGAGAAGATGAAACGCACTGTTTCACCACCGTCGTCG
TCGGTCTCAATCGCCATCCAGAGTACTTCAAAGAGCTGACGATCGATCCTTCCCATTCCGAGTATTCCATGTCCGATTTC
CGGAGGTTCCTAAGAGACACTTACTCGCTGAGAAACGCCGCCGTGAGTACCGGAGAAAGTCTGCGGCGGAGGCCACGGAT
CCTGATTATATCCAGAGCCAGATCGCGAGCCTTCACGAACACCGACGAGATCGCGAACGCGGCGGGAGAAATCGGATTCG
AAGTCGTGGTGGCGGAAGCGAACACAGGCGTCGCGAGTTTCGCGGAGACGGTGAACTCGTGCGACGTGATGCTCGGCGTT
CACGGCGCGGGGCTTACAAACATGGTGTTCTTGCCGGAGAACGCGGTGGTGTTTCAGATTCTTCCGATCGGTGGATTCGA
GTGGCTGGCGGAGACGGATTTCGGAAGGCCGGCGAAGGGGATGAACCTGACGTATTTGGAGTACAAGATCGAGGCGGAGG
AGAGCTCGCTTGTGCGGCAGTACGGCCGCGATCACGAGGTCGTTAGAGATCCATCGGCGGTTGCGAAACGCGGGTGGACG
GCGTTCAAGTCGGCCTATTTGGTAGGGCAGAACGTGACCGTTGATATAAACCGGTTCAAGCCGGTTCTTGCCAAAGCTTT
TGAGTTATTGCAGAGACAGTCGGTGTAA