Details for Kale Locus Bo5g120060

Position : C5 ( 5`- 36615552 .. 36617153 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g120060

Protein [Map View]
MAAVTASRPRASKAESFVDNKRKEDIRSANINAARAVADAVRTSLGPKGMDKMISTASGEVIITNDGATILNKMDVLQPA
AKMMVELSKSQDSAAGDGTTTVVVLAGALLRVCQTLLGSGIHPTVISDALHKSCAKSVDILTAMAVPVELTDRDSLVKSA
STSLNSKVVSQYSTLLAPLAVDAVLSVIDPEKPEIVDLRDIKIVKKLGGTVDDTHTVNGLVFDKKVSHAAGGPTRMENAK
IAVIQFQISPPKTDIEQSIVVSDYTQMDRILKEERNYILGMIKKIKATGCNVLLIQKSILRDAVTDLSLHYLAKAKIMVI
KDVERDEIEFVTKTLNCLPIANIEHFRAEKLGFADLVEEASLGDGKILKITGIKDMGRTTSVLVRGSNQLVLDEAERSLH
DALCVVRCLVSKRFLIAGGGAPEIELSRQLGAWAKVLHGMEGYCVKSFAEALEVIPYTLAENAGLNPIAIVTELRNKHAQ
GEINSGINVRKGQITNILEENVVQPLLVSTSAITLATECVRMILKIDDIVTVR*

DNA
ATGGCGGCGGTGACGGCATCGAGACCTCGCGCATCCAAGGCCGAATCCTTCGTAGACAACAAACGTAAAGAAGACATCCG
CTCCGCCAACATCAACGCCGCCCGCGCCGTCGCCGACGCCGTCCGCACGAGCCTGGGCCCTAAGGGGATGGACAAGATGA
TCTCCACCGCGAGCGGCGAGGTCATCATCACCAACGACGGAGCCACGATCCTCAACAAGATGGACGTTCTCCAGCCAGCG
GCGAAGATGATGGTGGAGCTTTCCAAATCGCAGGACTCAGCCGCCGGAGACGGGACCACAACGGTCGTGGTACTCGCCGG
AGCCTTGCTCAGAGTGTGCCAAACGCTTTTAGGTTCCGGGATCCACCCTACCGTGATCTCGGACGCGCTTCACAAGTCTT
GCGCGAAGTCCGTTGATATCTTGACCGCCATGGCTGTCCCCGTGGAGCTCACGGATCGAGATTCGTTAGTTAAATCGGCG
AGCACGTCGCTGAACAGTAAGGTTGTTAGTCAGTACTCTACTCTGCTCGCTCCGTTAGCTGTTGATGCGGTTTTATCAGT
GATAGATCCGGAGAAGCCGGAGATTGTTGATCTGCGTGATATCAAAATTGTTAAGAAGCTTGGTGGCACTGTTGACGATA
CGCACACTGTTAACGGTTTGGTGTTTGATAAAAAAGTTAGCCACGCTGCTGGTGGGCCCACGAGGATGGAGAATGCCAAG
ATCGCTGTGATTCAGTTCCAAATCTCGCCTCCCAAGACTGACATCGAGCAGAGTATTGTTGTCTCTGATTACACTCAGAT
GGATAGGATCTTGAAGGAAGAGAGGAACTACATCTTGGGGATGATTAAGAAGATCAAGGCCACTGGTTGCAATGTGTTGC
TGATTCAGAAGAGTATTTTGAGGGACGCTGTGACTGATTTGTCGCTTCATTATTTGGCGAAGGCTAAGATCATGGTGATT
AAGGATGTGGAGAGGGATGAGATTGAGTTTGTGACGAAGACGTTGAACTGCTTGCCGATTGCTAACATTGAGCATTTTAG
GGCTGAGAAGCTTGGTTTTGCTGATCTTGTTGAAGAAGCGTCGCTTGGAGATGGGAAGATTTTGAAGATCACTGGGATCA
AGGACATGGGGAGAACCACCTCTGTTCTTGTCCGTGGATCTAACCAGCTTGTCCTTGATGAAGCTGAGAGGAGTCTGCAC
GATGCGTTGTGTGTTGTCAGGTGTCTTGTGAGCAAGAGGTTTTTGATTGCAGGAGGTGGTGCGCCAGAGATTGAGCTCTC
GAGGCAGCTAGGCGCTTGGGCTAAGGTGCTCCATGGGATGGAAGGTTACTGTGTGAAGTCTTTTGCTGAAGCTCTGGAGG
TTATTCCTTACACGCTGGCTGAGAATGCAGGTTTGAATCCTATTGCCATTGTGACTGAGCTGAGGAACAAGCATGCTCAA
GGGGAGATCAACTCTGGGATCAATGTTAGGAAAGGGCAGATCACTAATATCTTGGAGGAAAACGTGGTGCAGCCTCTGCT
TGTGAGCACCAGCGCAATCACTCTCGCAACTGAATGCGTAAGGATGATTTTGAAGATCGATGACATCGTTACTGTGAGGT
AG