Details for Kale Locus Bo5g120050

Position : C5 ( 5`- 36612096 .. 36614123 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g120050

Protein [Map View]
MVDGNGTSAGNSHQIVSAAVRATVSCRKLRINPNNEVRPDNYEDLQLDFPNPVYKNLEKYLPPDMLVSNREERVRFMTDI
MLSHLPSGERSKAQKHSDYRSKIVSNYQPLHRELYNLVPRLCFVPSFLKAINENTEDSFRSIISEASPGVFVFDMLLPSF
CEMMLAEIDNFEKWVAETKFRIMRPNTMNKYGAVLDDFGLDTMLDKLMECFIRPISKVFFNDVGGATLDSHHGFVVEYGK
DRDVDLGFHVDDSEVTLNVCLGNQFVGGELFFRGTRCEKHVNTATKSDEIFDYCHVPGQAVLHRGRHRHGARATTSGHRV
NMLLWCRSSSFRELQRLQKDFSSWCGECSCEKREEKARTFDAIRKKYVKAVHAPQA*

DNA
ATGGTGGACGGTAACGGAACTAGTGCAGGCAACTCTCACCAGATTGTTTCTGCGGCGGTGAGAGCTACGGTTTCGTGCCG
TAAGCTGAGGATAAACCCTAACAACGAGGTTAGGCCAGATAATTACGAGGATCTGCAGCTCGATTTCCCTAATCCGGTTT
ACAAGAATCTGGAGAAGTACTTGCCTCCGGACATGCTGGTCTCGAACAGGGAAGAGAGAGTGAGGTTCATGACTGACATT
ATGCTCAGTCACCTTCCTAGTGGAGAGCGGTCCAAGGCTCAAAAGCACAGTGACTATAGGAGTAAGATAGTATCAAACTA
TCAGCCACTTCACAGGGAGCTGTATAATCTAGTTCCTAGACTATGTTTCGTTCCCTCTTTCCTAAAGGCGATAAATGAGA
ACACAGAGGATAGCTTCAGAAGCATCATATCTGAAGCTTCTCCTGGTGTTTTTGTCTTTGACATGCTCCTCCCTAGCTTC
TGCGAGATGATGCTAGCCGAGATAGACAATTTTGAAAAGTGGGTGGCTGAGACAAAATTCAGAATCATGAGACCAAACAC
AATGAATAAATACGGTGCTGTGCTTGACGACTTTGGCCTTGATACCATGCTTGACAAACTCATGGAATGTTTCATACGTC
CCATTTCCAAAGTGTTCTTCAATGATGTTGGTGGAGCAACTCTGGACTCTCACCATGGGTTTGTTGTCGAGTATGGTAAA
GATAGGGATGTTGATTTAGGCTTTCATGTGGATGATTCAGAAGTGACTCTGAACGTTTGTTTGGGTAACCAATTTGTGGG
AGGGGAGTTGTTTTTCAGAGGCACACGGTGTGAGAAACATGTTAACACAGCGACAAAGTCAGATGAGATATTTGATTATT
GTCATGTACCGGGGCAAGCTGTACTTCACCGCGGGCGCCACCGCCATGGTGCCAGAGCCACAACATCTGGACACAGGGTC
AACATGCTTCTATGGTGCAGAAGCTCTTCGTTTAGAGAGCTACAAAGACTTCAGAAGGACTTCTCCAGCTGGTGCGGAGA
GTGCTCTTGTGAAAAGAGAGAGGAGAAAGCACGGACGTTTGATGCTATAAGAAAGAAATATGTTAAAGCAGTGCATGCTC
CTCAGGCTTGA