Details for Kale Locus Bo5g120040

Position : C5 ( 5`- 36609239 .. 36610311 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g120040

Protein [Map View]
MWKEESLDLVLVPAGLAVMVAYHVWLGYTIIHRPKLTAISLNAESRRLWVFAMMDDPMKNGVLAVQTIRNNIMASTVLAT
TAITLCSIIGVFVSSNSPSESTASPMIYGNKSPLLATIKNFSILICFLMAFLCNVQSIRYYAHVSFLVTVPVSRGEKEHC
EYVARNLNRALYFWFLGLRAFYFSFPLFLWNFGPTPMFVCCCMMSSILYFLDTTTSFTRRLHSQSFRETAESMDGEIESV
VHAL*

DNA
ATGTGGAAGGAGGAATCGTTGGATTTAGTACTAGTGCCGGCGGGTCTCGCCGTGATGGTCGCTTACCATGTCTGGCTCGG
CTACACCATTATCCACCGTCCGAAGCTCACCGCTATCTCCCTCAACGCTGAATCTCGAAGACTATGGGTCTTCGCTATGA
TGGACGATCCGATGAAAAACGGTGTATTGGCAGTACAGACAATCAGGAACAACATAATGGCATCAACCGTTTTAGCCACA
ACAGCAATCACTCTCTGTTCCATCATCGGCGTCTTCGTAAGCAGCAACTCCCCTTCGGAATCCACAGCGTCGCCTATGAT
ATACGGCAACAAAAGCCCTCTCCTTGCAACCATCAAGAACTTCTCGATCCTCATCTGTTTCCTCATGGCCTTTCTCTGCA
ACGTCCAGTCCATCAGGTACTACGCCCACGTTAGTTTCCTAGTCACCGTGCCCGTCTCCAGAGGGGAAAAAGAGCACTGC
GAGTACGTGGCTAGGAACCTGAACCGAGCTCTCTACTTCTGGTTCCTCGGGTTGAGGGCCTTCTATTTCTCCTTCCCGCT
CTTCCTGTGGAACTTTGGTCCCACCCCCATGTTTGTGTGCTGTTGTATGATGTCTTCGATTTTGTATTTCTTGGACACGA
CCACTTCTTTTACTAGGCGTCTCCACAGCCAGTCGTTTAGAGAAACTGCTGAGTCGATGGATGGTGAAATCGAATCAGTG
GTTCATGCTCTCTAG